Stock Number Hs1769

Human Gene: TLL2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
TLL2 TOLLOID-LIKE 2 HGNC:11844 10q24.1 tok 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Scott Lab Collection IOH80813 NM_012465.2 pGW-HA.attB NM_012465.2 Reference Closed

Stocks

Docking Site DGRC BDSC FBti
VK37NO84949

Sequences

DNA sequence (3048 bp) Protein sequence (1016 aa)
ATGCCCCGGGCGACTGCACTTGGGGCCCTGGTGTCACTGCTGCTGCTGCT
GCCGCTGCCTCGCGGCGCCGGGGGACTCGGGGAGCGCCCGGACGCCACCG
CAGACTACTCAGAGCTGGACGGCGAGGAGGGCACGGAGCAGCAGCTGGAG
CATTACCACGACCCTTGCAAAGCCGCTGTCTTTTGGGGAGACATTGCCTT
AGATGAAGATGACTTGAAGCTGTTTCACATTGACAAAGCCAGAGACTGGA
CCAAGCAGACAGTGGGGGCAACAGGACACAGCACAGGTGGGCTTGAAGAG
CAGGCATCTGAGAGCAGCCCAGACACCACAGCCATGGACACTGGCACCAA
GGAAGCTGGAAAGGATGGCCGGGAGAATACCACACTCCTGCACAGCCCTG
GGACCTTGCATGCCGCAGCCAAGACCTTCTCTCCCCGGGTCCGAAGAGCC
ACAACCTCAAGGACAGAGAGGATATGGCCTGGAGGAGTCATCCCCTACGT
CATTGGAGGGAACTTCACTGGGAGCCAGAGGGCCATTTTTAAGCAGGCCA
TGAGACACTGGGAGAAGCACACCTGTGTGACCTTCATAGAAAGGACGGAT
GAGGAAAGCTTTATTGTATTCAGTTACAGAACCTGTGGCTGTTGCTCCTA
TGTTGGGCGCCGAGGAGGAGGCCCACAGGCCATATCCATTGGGAAGAACT
GTGACAAGTTTGGCATTGTGGCTCACGAGCTGGGCCATGTGGTTGGGTTT
TGGCATGAACACACCCGGCCAGACAGAGACCAACATGTCACCATCATCAG
GGAAAACATCCAGCCAGGTCAGGAGTATAATTTCTTAAAAATGGAAGCTG
GGGAAGTGAGCTCTCTGGGAGAGACATACGACTTTGACAGCATCATGCAC
TACGCCCGGAACACCTTCTCAAGAGGAGTTTTCTTAGACACCATCCTTCC
CCGTCAAGATGACAATGGCGTCAGGCCAACCATTGGCCAGCGCGTGCGGC
TCAGTCAGGGAGACATAGCTCAAGCCCGGAAGCTGTACAAATGCCCAGCG
TGTGGGGAGACCCTGCAGGACACAACGGGAAACTTTTCTGCACCTGGTTT
CCCAAATGGGTACCCATCTTACTCCCACTGCGTCTGGAGGATCTCGGTCA
CCCCAGGGGAAAAGATCGTATTAAACTTCACATCCATGGATTTGTTTAAA
AGCCGACTGTGCTGGTATGATTACGTGGAGGTCCGGGATGGTTACTGGAG
AAAAGCCCCCCTTTTGGGCAGGTTTTGTGGCGATAAGATCCCGGAGCCCC
TCGTCTCCACGGACAGCCGGCTCTGGGTGGAGTTCCGCAGCAGCAGCAAC
ATCTTGGGCAAGGGCTTCTTTGCAGCGTACGAAGCTACCTGCGGGGGAGA
CATGAACAAAGATGCCGGTCAGATTCAATCTCCCAACTATCCGGATGACT
ACAGACCTTCCAAGGAATGTGTCTGGAGGATTACGGTTTCAGAGGGGTTT
CACGTGGGACTTACCTTCCAAGCTTTTGAGATTGAAAGGCACGACAGCTG
TGCATATGACTACCTGGAAGTCCGGGATGGCCCCACGGAAGAGAGTGCCC
TGATCGGCCACTTTTGTGGCTATGAGAAGCCGGAGGATGTGAAATCGAGC
TCCAACAGACTGTGGATGAAGTTTGTGTCCGATGGCTCTATCAATAAAGC
GGGCTTTGCAGCCAATTTTTTCAAGGAGGTGGATGAGTGTTCCTGGCCAG
ATCACGGCGGGTGCGAGCATCGCTGTGTGAACACGCTGGGCAGCTACAAG
TGTGCCTGTGACCCTGGCTACGAGCTGGCCGCCGATAAGAAGATGTGTGA
AGTGGCCTGTGGCGGTTTCATTACCAAGCTGAATGGAACCATCACCAGCC
CTGGGTGGCCGAAGGAGTATCCCACAAACAAAAACTGTGTCTGGCAGGTG
GTGGCCCCCGCTCAGTACCGGATCTCCCTTCAGTTTGAAGTGTTTGAACT
GGAAGGCAATGACGTCTGTAAGTACGACTTTGTAGAGGTGCGCAGCGGCC
TGTCCCCCGACGCCAAGCTGCACGGCAGGTTCTGCGGCTCTGAGACGCCG
GAGGTCATCACCTCGCAGAGCAACAACATGCGCGTGGAGTTCAAGTCCGA
CAACACCGTCTCCAAGCGCGGCTTCAGGGCCCACTTCTTCTCAGATAAGG
ACGAGTGTGCCAAGGACAACGGCGGGTGTCAGCATGAGTGCGTCAACACC
TTCGGGAGCTACCTGTGCAGGTGCAGAAACGGCTACTGGCTCCACGAGAA
TGGGCATGACTGCAAAGAGGCTGGCTGTGCACACAAGATCAGCAGTGTGG
AGGGGACCCTGGCGAGCCCCAACTGGCCTGACAAATACCCCAGCCGGAGG
GAGTGTACCTGGAACATCTCTTCGACTGCAGGCCACAGAGTGAAACTCAC
CTTTAATGAGTTTGAGATCGAGCAGCACCAGGAATGTGCCTATGACCACC
TGGAAATGTATGACGGGCCGGACAGCCTGGCCCCCATTCTGGGCCGTTTC
TGCGGCAGCAAGAAACCAGACCCCACGGTGGCTTCCGGCAGCAGTATGTT
TCTCAGGTTTTATTCGGATGCCTCAGTGCAGAGGAAAGGCTTCCAGGCAG
TGCACAGCACAGAGTGCGGGGGCAGGCTGAAGGCTGAAGTGCAGACCAAA
GAGCTCTATTCCCACGCCCAGTTTGGGGACAACAACTACCCGAGCGAGGC
CCGCTGTGACTGGGTGATCGTGGCAGAGGACGGCTACGGCGTGGAGCTGA
CATTCCGGACCTTTGAGGTTGAGGAGGAGGCCGACTGCGGCTACGACTAC
ATGGAAGCCTACGACGGCTACGACAGCTCAGCGCCCAGGCTCGGCCGCTT
CTGTGGCTCTGGGCCATTAGAAGAAATCTACTCTGCAGGTGATTCCCTGA
TGATTCGATTCCGCACAGATGACACCATCAACAAGAAAGGCTTTCATGCC
CGATACACCAGCACCAAGTTCCAGGATGCCCTGCACATGAAGAAATAG
MPRATALGALVSLLLLLPLPRGAGGLGERPDATADYSELDGEEGTEQQLE
HYHDPCKAAVFWGDIALDEDDLKLFHIDKARDWTKQTVGATGHSTGGLEE
QASESSPDTTAMDTGTKEAGKDGRENTTLLHSPGTLHAAAKTFSPRVRRA
TTSRTERIWPGGVIPYVIGGNFTGSQRAIFKQAMRHWEKHTCVTFIERTD
EESFIVFSYRTCGCCSYVGRRGGGPQAISIGKNCDKFGIVAHELGHVVGF
WHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMH
YARNTFSRGVFLDTILPRQDDNGVRPTIGQRVRLSQGDIAQARKLYKCPA
CGETLQDTTGNFSAPGFPNGYPSYSHCVWRISVTPGEKIVLNFTSMDLFK
SRLCWYDYVEVRDGYWRKAPLLGRFCGDKIPEPLVSTDSRLWVEFRSSSN
ILGKGFFAAYEATCGGDMNKDAGQIQSPNYPDDYRPSKECVWRITVSEGF
HVGLTFQAFEIERHDSCAYDYLEVRDGPTEESALIGHFCGYEKPEDVKSS
SNRLWMKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEHRCVNTLGSYK
CACDPGYELAADKKMCEVACGGFITKLNGTITSPGWPKEYPTNKNCVWQV
VAPAQYRISLQFEVFELEGNDVCKYDFVEVRSGLSPDAKLHGRFCGSETP
EVITSQSNNMRVEFKSDNTVSKRGFRAHFFSDKDECAKDNGGCQHECVNT
FGSYLCRCRNGYWLHENGHDCKEAGCAHKISSVEGTLASPNWPDKYPSRR
ECTWNISSTAGHRVKLTFNEFEIEQHQECAYDHLEMYDGPDSLAPILGRF
CGSKKPDPTVASGSSMFLRFYSDASVQRKGFQAVHSTECGGRLKAEVQTK
ELYSHAQFGDNNYPSEARCDWVIVAEDGYGVELTFRTFEVEEEADCGYDY
MEAYDGYDSSAPRLGRFCGSGPLEEIYSAGDSLMIRFRTDDTINKKGFHA
RYTSTKFQDALHMKK*

Index