Stock Number Hs1566

Human Gene: RBBP7


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
RBBP7 RB binding protein 7, chromatin remodeling factor HGNC:9890 Xp22.2 Caf1-55 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO04002 pGW-HA.attB ENST00000425696.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166215284948

Sequences

DNA sequence (1509 bp) Protein sequence (503 aa)
ATGGCGAGTAAAGAGATGTTTGAAGATACTGTGGAGGAGCGTGTCATCAA
TGAAGAATATAAAATCTGGAAGAAGAATACACCGTTTCTATATGACCTGG
TTATGACCCATGCTCTTCAGTGGCCCAGTCTTACCGTTCAGTGGCTTCCT
GAAGTGACTAAACCTGAAGGAAAAGATTATGCCCTTCATTGGCTAGTGCT
GGGGACTCATACGTCTGATGAGCAGAATCATCTGGTGGTTGCTCGAGTAC
ATATTCCCAATGATGATGCACAGTTTGATGCTTCCCATTGTGACAGTGAC
AAGGGTGAATTTGGTGGCTTTGGTTCTGTAACAGGAAAAATTGAATGTGA
AATTAAAATCAATCACGAAGGAGAAGTAAACCGTGCTCGTTACATGCCGC
AGAATCCTCACATCATTGCTACAAAAACACCATCTTCTGATGTGTTGGTT
TTTGACTATACAAAACACCCTGCTAAACCAGACCCAAGTGGAGAATGTAA
TCCTGATCTCAGATTAAGAGGTCACCAGAAGGAAGGCTATGGTCTCTCCT
GGAATTCAAATTTGAGTGGACATCTCCTAAGTGCATCTGATGACCATACT
GTTTGTCTGTGGGATATAAACGCAGGACCAAAAGAAGGCAAAATTGTGGA
TGCTAAAGCCATCTTTACTGGCCACTCAGCTGTTGTAGAGGATGTGGCCT
GGCACCTGCTGCACGAGTCATTGTTTGGATCTGTTGCTGATGATCAGAAA
CTTATGATATGGGACACCAGGTCCAATACCACCTCCAAGCCGAGTCACTT
GGTGGATGCGCACACTGCCGAAGTCAACTGCCTCTCATTCAATCCCTACA
GCGAATTTATTCTAGCCACCGGCTCTGCGGATAAGACCGTAGCTTTATGG
GATCTGCGTAACTTAAAATTAAAACTCCATACCTTCGAATCTCATAAAGA
TGAAATTTTCCAGGTCCACTGGTCTCCACATAATGAAACTATTCTGGCTT
CAAGTGGTACTGACCGCCGCCTGAATGTGTGGGATTTAAGTAAAATTGGG
GAAGAACAATCAGCAGAAGATGCAGAAGATGGGCCTCCAGAACTCCTGTT
TATTCATGGAGGACACACTGCTAAGATTTCAGATTTTAGCTGGAACCCCA
ATGAGCCTTGGGTCATTTGCTCAGTGTCTGAGGATAACATCATGCAGATA
TGGCAAATGGCTGAAAATATTTACAATGATGAAGAGTCAGATGTCACGAC
ATCCGAACTGGAGGGACAAGGATCTTTGCCAACTTTCTTGTACAAAGTGG
TGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTT
GGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGG
ACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATC
CCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGAT
TACGCTTGA
MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLP
EVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSD
KGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLV
FDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHT
VCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQK
LMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALW
DLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIG
EEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQI
WQMAENIYNDEESDVTTSELEGQGSLPTFLYKVVVPRSSYSLLSIGTSIL
GAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPD
YA*

Index