Stock Number Hs1564

Human Gene: STAMBPL1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
STAMBPL1 STAM binding protein like 1 HGNC:24105 10q23.31 CG2224 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03983 pGW-HA.attB ENST00000371922.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166215084947

Sequences

DNA sequence (1497 bp) Protein sequence (499 aa)
ATGCCTGACCATACAGATGTTTCCCTAAGCCCAGAAGAGCGAGTCCGTGC
CCTAAGCAAGCTTGGTTGTAATATCACCATCAGTGAAGACATCACTCCAC
GACGTTACTTTAGGTCTGGAGTAGAGATGGAGAGGATGGCGTCTGTGTAT
TTGGAAGAAGGAAATTTGGAAAATGCCTTTGTTCTTTATAATAAATTTAT
AACCTTATTTGTAGAAAAGCTTCCTAACCATCGAGATTACCAGCAATGTG
CAGTACCTGAAAAGCAGGATATTATGAAGAAACTGAAGGAGATTGCATTC
CCAAGGACAGATGAATTGAAAAACGACCTTTTAAAGAAATATAACGTAGA
ATACCAAGAATATTTGCAAAGCAAAAACAAATATAAAGCTGAAATTCTCA
AAAAATTGGAGCATCAGAGATTGATAGAGGCAGAAAGGAAGCGGATTGCT
CAGATGCGCCAGCAGCAGCTAGAATCGGAGCAGTTTCTGTTTTTCGAAGA
TCAACTCAAGAAGCAAGAGTTAGCCCGAGGTCAAATGCGAAGTCAGCAAA
CCTCAGGGCTGTCAGAGCAGATTGATGGGAGCGCTTTGTCCTGCTTTTCC
ACACACCAGAACAATTCCTTGCTGAATGTATTTGCAGATCAACCTAATAA
AAGTGATGCAACCAATTATGCTAGCCACTCTCCTCCTGTAAACAGGGCCT
TAACACCAGCTGCTACTCTAAGTGCTGTTCAGAATTTAGTGGTTGAAGGA
CTGCGATGTGTAGTTTTGCCAGAAGATCTTTGCCACAAATTTCTGCAACT
GGCAGAATCTAATACAGTGAGAGGAATAGAAACCTGTGGAATACTCTGTG
GAAAACTGACACATAATGAATTTACTATTACCCATGTAATTGTGCCAAAG
CAGTCTGCGGGACCAGACTATTGTGACATGGAGAATGTAGAGGAATTATT
CAATGTTCAGGATCAACATGATCTCCTCACTCTAGGATGGATCCATACAC
ATCCCACTCAAACTGCATTTTTATCCAGCGTTGATCTTCACACTCACTGT
TCCTATCAACTCATGTTGCCAGAGGCCATTGCCATTGTTTGCTCACCAAA
GCATAAAGACACTGGCATCTTCAGGCTCACCAATGCTGGCATGCTTGAGG
TTTCTGCTTGTAAAAAAAAGGGCTTTCATCCACACACCAAGGAGCCCAGG
CTGTTCAGTATATGCAAACATGTGTTGGTAAAAGACATAAAAATAATTGT
GTTGGATCTGAGGTGCCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAA
GTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCA
GGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTT
AATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCC
CGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MPDHTDVSLSPEERVRALSKLGCNITISEDITPRRYFRSGVEMERMASVY
LEEGNLENAFVLYNKFITLFVEKLPNHRDYQQCAVPEKQDIMKKLKEIAF
PRTDELKNDLLKKYNVEYQEYLQSKNKYKAEILKKLEHQRLIEAERKRIA
QMRQQQLESEQFLFFEDQLKKQELARGQMRSQQTSGLSEQIDGSALSCFS
THQNNSLLNVFADQPNKSDATNYASHSPPVNRALTPAATLSAVQNLVVEG
LRCVVLPEDLCHKFLQLAESNTVRGIETCGILCGKLTHNEFTITHVIVPK
QSAGPDYCDMENVEELFNVQDQHDLLTLGWIHTHPTQTAFLSSVDLHTHC
SYQLMLPEAIAIVCSPKHKDTGIFRLTNAGMLEVSACKKKGFHPHTKEPR
LFSICKHVLVKDIKIIVLDLRCPTFLYKVVVPRSSYSLLSIGTSILGAPS
GGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index