Stock Number Hs1563

Human Gene: ARRB1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
ARRB1 arrestin beta 1 HGNC:711 11q13.4 krz 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03975 pGW-HA.attB ENST00000360025.7 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166214984946

Sequences

DNA sequence (1488 bp) Protein sequence (496 aa)
ATGGGCGACAAAGGGACCCGAGTGTTCAAGAAGGCCAGTCCAAATGGAAA
GCTCACCGTCTACCTGGGAAAGCGGGACTTTGTGGACCACATCGACCTCG
TGGACCCTGTGGATGGTGTGGTCCTGGTGGATCCTGAGTATCTCAAAGAG
CGGAGAGTCTATGTGACGCTGACCTGCGCCTTCCGCTATGGCCGGGAGGA
CCTGGATGTCCTGGGCCTGACCTTTCGCAAGGACCTGTTTGTGGCCAACG
TACAGTCGTTCCCACCGGCCCCCGAGGACAAGAAGCCCCTGACGCGGCTG
CAGGAACGCCTCATCAAGAAGCTGGGCGAGCACGCTTACCCTTTCACCTT
TGAGATCCCTCCAAACCTTCCATGTTCTGTGACACTGCAGCCGGGGCCCG
AAGACACGGGGAAGGCTTGCGGTGTGGACTATGAAGTCAAAGCCTTCTGC
GCGGAGAATTTGGAGGAGAAGATCCACAAGCGGAATTCTGTGCGTCTGGT
CATCCGGAAGGTTCAGTATGCCCCAGAGAGGCCTGGCCCCCAGCCCACAG
CCGAGACCACCAGGCAGTTCCTCATGTCGGACAAGCCCTTGCACCTAGAA
GCCTCTCTGGATAAGGAGATCTATTACCATGGAGAACCCATCAGCGTCAA
CGTCCACGTCACCAACAACACCAACAAGACGGTGAAGAAGATCAAGATCT
CAGTGCGCCAGTATGCAGACATCTGCCTTTTCAACACAGCTCAGTACAAG
TGCCCTGTTGCCATGGAAGAGGCTGATGACACTGTGGCACCCAGCTCGAC
GTTCTGCAAGGTCTACACACTGACCCCCTTCCTAGCCAATAACCGAGAGA
AGCGGGGCCTCGCCTTGGACGGGAAGCTCAAGCACGAAGACACGAACTTG
GCCTCTAGCACCCTGTTGAGGGAAGGTGCCAACCGTGAGATCCTGGGGAT
CATTGTTTCCTACAAAGTGAAAGTGAAGCTGGTGGTGTCTCGGGGCGGCC
TGTTGGGAGATCTTGCATCCAGCGACGTGGCCGTGGAACTGCCCTTCACC
CTAATGCACCCCAAGCCCAAAGAGGAACCCCCGCATCGGGAAGTTCCAGA
GAACGAGACGCCAGTAGATACCAATCTCATAGAACTTGACACAAATGATG
ACGACATTGTATTTGAGGACTTTGCTCGCCAGAGACTGAAAGGCATGAAG
GATGACAAGGAGGAAGAGGAGGATGGTACCGGCTCTCCACAGCTCAACAA
CAGATACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATT
CTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGT
GCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCC
ATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATG
CAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKE
RRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRL
QERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFC
AENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLE
ASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYK
CPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFT
LMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMK
DDKEEEEDGTGSPQLNNRYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGG
ATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index