Stock Number Hs1561

Human Gene: STAM


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
STAM signal transducing adaptor molecule HGNC:11357 10p12.33 Stam 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03695 pGW-HA.attB ENST00000445846.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166214784945

Sequences

DNA sequence (1443 bp) Protein sequence (481 aa)
ATGCCTCTTTTTGCCACCAATCCCTTCGATCAGGATGTTGAGAAAGCAAC
CAGCGAGATGAATACTGCTGAGGACTGGGGCCTCATTTTGGATATCTGTG
ATAAAGTTGGTCAGTCTCGCACTGGACCTAAGGATTGTCTTCGGTCTATT
ATGAGAAGAGTGAACCACAAAGATCCTCACGTTGCTATGCAGGCTTTGAC
TCTTCTAGGAGCATGTGTATCAAACTGTGGCAAAATTTTTCATTTAGAAG
TATGTTCAAGAGATTTTGCTAGTGAAGTAAGCAACGTATTAAATAAGGGT
CATCCTAAAGTATGTGAAAAATTAAAGGCTCTTATGGTTGAATGGACAGA
TGAATTTAAGAATGATCCACAGCTTAGTCTAATATCAGCAATGATTAAGA
ACCTTAAGGAACAAGGAGTTACGTTCCCAGCTATTGGCTCTCAGGCTGCA
GAACAAGCAAAAGCAAGCCCAGCTCTTGTAGCCAAGGATCCTGGTACTGT
GGCTAACAAAAAAGAAGAAGAAGATTTAGCAAAAGCCATTGAGTTGTCTC
TCAAGGAACAAAGGCAGCAGTCAACCACCCTTTCCACTTTGTATCCAAGC
ACATCCAGTCTCTTAACTAACCACCAACATGAAGGCCGAAAAGTTCGTGC
TATATATGACTTTGAAGCTGCTGAAGACAATGAACTTACTTTTAAAGCTG
GAGAAATTATTACAGTTCTTGATGACAGTGATCCTAACTGGTGGAAAGGT
GAAACCCATCAAGGCATAGGGTTATTTCCTTCTAATTTTGTGACTGCATA
TCTCACTGCTGAACCAGAAATGATTAAAACAGAGAAGAAGACGGTACAAT
TTAGTGATGATGTTCAGGTAGAGACAATAGAACCAGAGCCGGAACCAGCC
TTTATTGATGAAGATAAAATGGACCAGTTGCTACAGATGCTGCAAAGTAC
AGACCCCAGTGATGATCAGCCAGACCTACCAGAGCTGCTTCATCTTGAAG
CAATGTGTCACCAGATGGGACCTCTCATTGATGAAAAGCTGGAAGATATT
GATAGAAAACATTCAGAACTCTCAGAACTTAATGTGAAAGTGATGGAGGC
CCTTTCCTTATATACCAAGTTAATGAACGAAGATCCGATGTATTCCATGT
ATGCAAAGTTACAGAATCAGCCAGGCAGTGGTCCCACCATCCGCAAACCC
AGCCCTTCCTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTC
CTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAG
GCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATT
TACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGA
CTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSI
MRRVNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKG
HPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAA
EQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPS
TSSLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKG
ETHQGIGLFPSNFVTAYLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEPA
FIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDI
DRKHSELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQNQPGSGPTIRKP
SPSYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLI
YPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index