Stock Number Hs1559

Human Gene: DDR1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
DDR1 discoidin domain receptor tyrosine kinase 1 HGNC:2730 6p21.33 Ddr 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03506 pGW-HA.attB ENST00000509639.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166214584944

Sequences

DNA sequence (2862 bp) Protein sequence (954 aa)
ATGGGACCAGAGGCCCTGTCATCTTTACTGCTGCTGCTCTTGGTGGCAAG
TGGAGATGCTGACATGAAGGGACATTTTGATCCTGCCAAGTGCCGCTATG
CCCTGGGCATGCAGGACCGGACCATCCCAGACAGTGACATCTCTGCTTCC
AGCTCCTGGTCAGATTCCACTGCCGCCCGCCACAGCAGGTTGGAGAGCAG
TGACGGGGATGGGGCCTGGTGCCCCGCAGGGTCGGTGTTTCCCAAGGAGG
AGGAGTACTTGCAGGTGGATCTACAACGACTGCACCTGGTGGCTCTGGTG
GGCACCCAGGGACGGCATGCCGGGGGCCTGGGCAAGGAGTTCTCCCGGAG
CTACCGGCTGCGTTACTCCCGGGATGGTCGCCGCTGGATGGGCTGGAAGG
ACCGCTGGGGTCAGGAGGTGATCTCAGGCAATGAGGACCCTGAGGGAGTG
GTGCTGAAGGACCTTGGGCCCCCCATGGTTGCCCGACTGGTTCACTTCTA
CCCCCGGGCTGACCGGGTCATGAGCGTCTGTCTGCGGGTAGAGCTCTATG
GCTGCCTCTGGAGGGATGGACTCCTGTCTTACACCGCCCCTGTGGGGCAG
ACAATGTATTTATCTGAGGCCGTGTACCTCAACGACTCCACCTATGACGG
ACATACCGTGGGCGGACTGCAGTATGGGGGTCTGGGCCAGCTGGCAGATG
GTGTGGTGGGGCTGGATGACTTTAGGAAGAGTCAGGAGCTGCGGGTCTGG
CCAGGCTATGACTATGTGGGATGGAGCAACCACAGCTTCTCCAGTGGCTA
TGTGGAGATGGAGTTTGAGTTTGACCGGCTGAGGGCCTTCCAGGCTATGC
AGGTCCACTGTAACAACATGCACACGCTGGGAGCCCGTCTGCCTGGCGGG
GTGGAATGTCGCTTCCGGCGTGGCCCTGCCATGGCCTGGGAGGGGGAGCC
CATGCGCCACAACCTAGGGGGCAACCTGGGGGACCCCAGAGCCCGGGCTG
TCTCAGTGCCCCTTGGCGGCCGTGTGGCTCGCTTTCTGCAGTGCCGCTTC
CTCTTTGCGGGGCCCTGGTTACTCTTCAGCGAAATCTCCTTCATCTCTGA
TGTGGTGAACAATTCCTCTCCGGCACTGGGAGGCACCTTCCCGCCAGCCC
CCTGGTGGCCGCCTGGCCCACCTCCCACCAACTTCAGCAGCTTGGAGCTG
GAGCCCAGAGGCCAGCAGCCCGTGGCCAAGGCCGAGGGGAGCCCGACCGC
CATCCTCATCGGCTGCCTGGTGGCCATCATCCTGCTCCTGCTGCTCATCA
TTGCCCTCATGCTCTGGCGGCTGCACTGGCGCAGGCTCCTCAGCAAGGCT
GAACGGAGGGTGTTGGAAGAGGAGCTGACGGTTCACCTCTCTGTCCCTGG
GGACACTATCCTCATCAACAACCGCCCAGGTCCTAGAGAGCCACCCCCGT
ACCAGGAGCCCCGGCCTCGTGGGAATCCGCCCCACTCTGCTCCCTGTGTC
CCCAATGGCTCTGCCTACAGTGGGGACTATATGGAGCCTGAGAAGCCAGG
CGCCCCGCTTCTGCCCCCACCTCCCCAGAACAGCGTCCCCCATTATGCCG
AGGCTGACATTGTTACCCTGCAGGGCGTCACCGGGGGCAACACCTATGCT
GTGCCTGCACTGCCCCCAGGGGCAGTCGGGGATGGGCCCCCCAGAGTGGA
TTTCCCTCGATCTCGACTCCGCTTCAAGGAGAAGCTTGGCGAGGGCCAGT
TTGGGGAGGTGCACCTGTGTGAGGTCGACAGCCCTCAAGATCTGGTCAGT
CTTGATTTCCCCCTTAATGTGCGTAAGGGACACCCTTTGCTGGTAGCTGT
CAAGATCTTACGGCCAGATGCCACCAAGAATGCCAGGAATGATTTCCTGA
AAGAGGTGAAGATCATGTCGAGGCTCAAGGACCCAAACATCATTCGGCTG
CTGGGCGTGTGTGTGCAGGACGACCCCCTCTGCATGATTACTGACTACAT
GGAGAACGGCGACCTCAACCAGTTCCTCAGTGCCCACCAGCTGGAGGACA
AGGCAGCCGAGGGGGCCCCTGGGGACGGGCAGGCTGCGCAGGGGCCCACC
ATCAGCTACCAAATGCTGCTGCATGTGGCAGCCCAGATCGCCTCCGGCAT
GCGCTATCTGGCCACACTCAACTTTGTACATCGGGACCTGGCCACGCGGA
ACTGCCTAGTTGGGGAAAATTTCACCATCAAAATCGCAGACTTTGGCATG
AGCCGGAACCTCTATGCTGGGGACTATTACCGTGTGCAGGGCCGGGCAGT
GCTGCCCATCCGCTGGATGGCCTGGGAGTGCATCCTCATGGGGAAGTTCA
CGACTGCGAGTGACGTGTGGGCCTTTGGTGTGACCCTGTGGGAGGTGCTG
ATGCTCTGTAGGGCCCAGCCCTTTGGGCAGCTCACCGACGAGCAGGTCAT
CGAGAACGCGGGGGAGTTCTTCCGGGACCAGGGCCGGCAGGTGTACCTGT
CCCGGCCGCCTGCCTGCCCGCAGGGCCTATATGAGCTGATGCTTCGGTGC
TGGAGCCGGGAGTCTGAGCAGCGACCACCCTTTTCCCAGCTGCATCGGTT
CCTGGCAGAGGATGCACTCAACACGGTGTGCCCAACTTTCTTGTACAAAG
TGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATC
CTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGG
TGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCT
ATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCA
GATTACGCTTGA
MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISAS
SSWSDSTAARHSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALV
GTQGRHAGGLGKEFSRSYRLRYSRDGRRWMGWKDRWGQEVISGNEDPEGV
VLKDLGPPMVARLVHFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQ
TMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVW
PGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGG
VECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRF
LFAGPWLLFSEISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLEL
EPRGQQPVAKAEGSPTAILIGCLVAIILLLLLIIALMLWRLHWRRLLSKA
ERRVLEEELTVHLSVPGDTILINNRPGPREPPPYQEPRPRGNPPHSAPCV
PNGSAYSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGVTGGNTYA
VPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVS
LDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRL
LGVCVQDDPLCMITDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQGPT
ISYQMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGM
SRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVL
MLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRC
WSRESEQRPPFSQLHRFLAEDALNTVCPTFLYKVVVPRSSYSLLSIGTSI
LGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVP
DYA*

Index