Stock Number Hs1557

Human Gene: ARPC1B


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
ARPC1B actin related protein 2/3 complex subunit 1B HGNC:704 7q22.1 Arpc1 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03251 pGW-HA.attB ENST00000451682.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166214384942

Sequences

DNA sequence (1350 bp) Protein sequence (450 aa)
ATGGCCTACCACAGCTTCCTGGTGGAGCCCATCAGCTGCCACGCCTGGAA
CAAGGACCGCACCCAGATTGCCATCTGCCCCAACAACCATGAGGTGCATA
TCTATGAAAAGAGCGGTGCCAAATGGACCAAGGTGCACGAGCTCAAGGAG
CACAACGGGCAGGTGACAGGCATCGACTGGGCCCCCGAGAGTAACCGTAT
TGTGACCTGCGGCACAGACCGCAACGCCTACGTGTGGACGCTGAAGGGCC
GCACATGGAAGCCCACGCTGGTCATCCTGCGGATCAACCGGGCTGCCCGC
TGCGTGCGCTGGGCCCCCAACGAGAACAAGTTTGCTGTGGGCAGCGGCTC
TCGTGTGATCTCCATCTGTTATTTCGAGCAGGAGAATGACTGGTGGGTTT
GCAAGCACATCAAGAAGCCCATCCGCTCCACCGTCCTCAGCCTGGACTGG
CACCCCAACAATGTGCTGCTGGCTGCCGGCTCCTGTGACTTCAAGTGTCG
GATCTTTTCAGCCTACATCAAGGAGGTGGAGGAACGGCCGGCACCCACCC
CGTGGGGCTCCAAGATGCCCTTTGGGGAACTGATGTTCGAATCCAGCAGT
AGCTGCGGCTGGGTACATGGCGTCTGTTTCTCAGCCAGCGGGAGCCGCGT
GGCCTGGGTAAGCCACGACAGCACCGTCTGCCTGGCTGATGCCGACAAGA
AGATGGCCGTCGCGACTCTGGCCTCTGAAACACTACCACTGCTGGCGCTG
ACCTTCATCACAGACAACAGCCTGGTGGCAGCGGGCCACGACTGCTTCCC
GGTGCTGTTCACCTATGACGCCGCCGCGGGGATGCTGAGCTTCGGCGGGC
GGCTGGACGTTCCTAAGCAGAGCTCGCAGCGTGGCTTGACGGCCCGCGAG
CGCTTCCAGAACCTGGACAAGAAGGCGAGCTCCGAGGGTGGCACGGCTGC
GGGCGCGGGCCTAGACTCGCTGCACAAGAACAGCGTCAGCCAGATCTCGG
TGCTCAGCGGCGGCAAGGCCAAGTGCTCGCAGTTCTGCACCACTGGCATG
GATGGCGGCATGAGTATCTGGGATGTGAAGAGCTTGGAGTCAGCCTTGAA
GGACCTCAAGATCAAATGCCCAACTTTCTTGTACAAAGTGGTGGTACCTC
GAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCT
TCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGG
GTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACG
TCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MAYHSFLVEPISCHAWNKDRTQIAICPNNHEVHIYEKSGAKWTKVHELKE
HNGQVTGIDWAPESNRIVTCGTDRNAYVWTLKGRTWKPTLVILRINRAAR
CVRWAPNENKFAVGSGSRVISICYFEQENDWWVCKHIKKPIRSTVLSLDW
HPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGSKMPFGELMFESSS
SCGWVHGVCFSASGSRVAWVSHDSTVCLADADKKMAVATLASETLPLLAL
TFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARE
RFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGM
DGGMSIWDVKSLESALKDLKIKCPTFLYKVVVPRSSYSLLSIGTSILGAP
SGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index