Stock Number Hs1555

Human Gene: YBX2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
YBX2 Y-box binding protein 2 HGNC:17948 17p13.1 yps 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03221 pGW-HA.attB ENST00000007699.9 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166214184941

Sequences

DNA sequence (1326 bp) Protein sequence (442 aa)
ATGAGCGAGGTGGAGGCGGCAGCGGGGGCTACAGCGGTCCCCGCGGCGAC
GGTGCCCGCGACGGCGGCAGGGGTGGTAGCGGTGGTGGTACCGGTGCCCG
CAGGGGAGCCGCAGAAAGGCGGCGGGGCGGGCGGCGGGGGCGGAGCCGCC
TCGGGCCCCGCTGCTGGGACCCCCTCGGCGCCGGGCTCCCGCACCCCTGG
CAATCCGGCGACGGCGGTCTCGGGAACCCCCGCCCCCCCGGCCCGGAGTC
AGGCGGACAAGCCGGTGCTGGCAATCCAAGTCCTGGGCACTGTCAAATGG
TTCAACGTCCGGAATGGTTACGGATTCATCAACAGGAATGACACCAAGGA
AGATGTCTTTGTTCACCAGACAGCTATTAAAAGAAACAACCCCAGGAAGT
TTCTGCGCAGCGTTGGAGATGGGGAGACTGTGGAATTTGATGTCGTGGAA
GGAGAGAAGGGCGCAGAAGCCACTAATGTAACTGGGCCTGGGGGAGTACC
CGTGAAGGGCAGCCGTTATGCCCCCAACCGACGTAAGTCCCGCCGATTCA
TCCCCCGGCCTCCCTCAGTTGCCCCACCACCCATGGTGGCAGAGATCCCC
TCGGCGGGGACAGGACCTGGCAGTAAAGGGGAGCGGGCTGAAGACTCTGG
GCAACGGCCCCGACGATGGTGCCCCCCACCCTTCTTCTACCGACGGCGGT
TTGTGCGAGGCCCCCGGCCTCCCAACCAGCAGCAGCCTATAGAGGGCACT
GACAGGGTAGAACCCAAAGAGACAGCCCCATTGGAGGGGCACCAACAGCA
GGGAGATGAGCGAGTCCCCCCGCCCAGATTCCGGCCCAGGTACCGAAGGC
CTTTCCGCCCCAGGCCACGCCAGCAGCCTACCACAGAAGGTGGGGATGGT
GAGACCAAGCCCAGCCAAGGTCCCGCTGATGGTTCCCGGCCTGAGCCCCA
GCGCCCACGAAACCGCCCCTACTTCCAGCGGAGACGGCAGCAGGCCCCTG
GCCCCCAGCAGGCCCCTGGCCCCCGGCAGCCCGCAGCCCCTGAGACCTCA
GCCCCTGTCAACAGTGGGGACCCCACCACCACCATCCTGGAGTGCCCAAC
TTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTA
TAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGC
GCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCC
TGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATC
CATATGACGTTCCAGATTACGCTTGA
MSEVEAAAGATAVPAATVPATAAGVVAVVVPVPAGEPQKGGGAGGGGGAA
SGPAAGTPSAPGSRTPGNPATAVSGTPAPPARSQADKPVLAIQVLGTVKW
FNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVE
GEKGAEATNVTGPGGVPVKGSRYAPNRRKSRRFIPRPPSVAPPPMVAEIP
SAGTGPGSKGERAEDSGQRPRRWCPPPFFYRRRFVRGPRPPNQQQPIEGT
DRVEPKETAPLEGHQQQGDERVPPPRFRPRYRRPFRPRPRQQPTTEGGDG
ETKPSQGPADGSRPEPQRPRNRPYFQRRRQQAPGPQQAPGPRQPAAPETS
APVNSGDPTTTILECPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAG
AGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index