Stock Number Hs1554

Human Gene: TEAD1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
TEAD1 TEA domain transcription factor 1 HGNC:11714 11p15.3 sd X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03084 pGW-HA.attB ENST00000334310.10 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166214084940

Sequences

DNA sequence (1305 bp) Protein sequence (435 aa)
ATGGAAAGGATGAGTGACTCTGCAGATAAGCCAATTGACAATGATGCAGA
AGGGGTCTGGAGCCCCGACATCGAGCAAAGCTTTCAGGAGGCCCTGGCTA
TCTATCCACCATGTGGGAGGAGGAAAATCATCTTATCAGACGAAGGCAAA
ATGTATGGTAGGAATGAATTGATAGCCAGATACATCAAACTCAGGACAGG
CAAGACGAGGACCAGAAAACAGGTGTCTAGTCACATTCAGGTTCTTGCCA
GAAGGAAATCTCGTGATTTTCATTCCAAGCTAAAGGTAACAAGCATGGAT
CAGACTGCAAAGGATAAGGCCCTGCAGCACATGGCGGCCATGTCCTCAGC
CCAGATCGTCTCGGCCACTGCCATTCATAACAAGCTGGGGCTGCCTGGGA
TTCCACGCCCGACCTTCCCAGGGGCGCCGGGGTTCTGGCCGGGAATGATT
CAAACAGGGCAGCCAGGATCCTCACAAGACGTCAAGCCTTTTGTGCAGCA
GGCCTACCCCATCCAGCCAGCGGTCACAGCCCCCATTCCAGGGTTTGAGC
CTGCATCGGCCCCAGCTCCCTCAGTCCCTGCCTGGCAAGGTCGCTCCATT
GGCACAACCAAGCTTCGCCTGGTGGAATTTTCAGCTTTTCTCGAGCAGCA
GCGAGACCCAGACTCGGCTGATTTAAACTGCAATATTCAAGATGATGCTG
GGGCTTTTTATGGTGTAACCAGTCAGTACGAGAGTTCTGAAAATATGACA
GTCACCTGTTCCACCAAAGTTTGCTCCTTTGGGAAGCAAGTAGTAGAAAA
AGTAGAGACGGAGTATGCAAGGTTTGAGAATGGCCGATTTGTATACCGAA
TAAACCGCTCCCCAATGTGTGAATATATGATCAACTTCATCCACAAGCTC
AAACACTTACCAGAGAAATATATGATGAACAGTGTTTTGGAAAACTTCAC
AATTTTATTGGTGGTAACAAACAGGGATACACAAGAAACTCTACTCTGCA
TGGCCTGTGTGTTTGAAGTTTCAAATAGTGAACACGGAGCACAACATCAT
ATTTACAGGCTTGTAAAGGACTTGCCAACTTTCTTGTACAAAGTGGTGGT
ACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAG
CTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCT
GCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTA
TGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACG
CTTGA
MERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGK
MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSRDFHSKLKVTSMD
QTAKDKALQHMAAMSSAQIVSATAIHNKLGLPGIPRPTFPGAPGFWPGMI
QTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPAPSVPAWQGRSI
GTTKLRLVEFSAFLEQQRDPDSADLNCNIQDDAGAFYGVTSQYESSENMT
VTCSTKVCSFGKQVVEKVETEYARFENGRFVYRINRSPMCEYMINFIHKL
KHLPEKYMMNSVLENFTILLVVTNRDTQETLLCMACVFEVSNSEHGAQHH
IYRLVKDLPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGP
AGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index