Stock Number Hs1552

Human Gene: PCBP1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
PCBP1 poly(rC) binding protein 1 HGNC:8647 2p13.3 mub 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03182 pGW-HA.attB ENST00000303577.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166213884938

Sequences

DNA sequence (1302 bp) Protein sequence (434 aa)
ATGGATGCCGGTGTGACTGAAAGTGGACTAAATGTGACTCTCACCATTCG
GCTTCTTATGCACGGAAAGGAAGTAGGAAGCATCATTGGGAAGAAAGGGG
AGTCGGTTAAGAGGATCCGCGAGGAGAGTGGCGCGCGGATCAACATCTCG
GAGGGGAATTGTCCGGAGAGAATCATCACTCTGACCGGCCCCACCAATGC
CATCTTTAAGGCTTTCGCTATGATCATCGACAAGCTGGAGGAAGATATCA
ACAGCTCCATGACCAACAGTACCGCGGCCAGCAGGCCCCCGGTCACCCTG
AGGCTGGTGGTGCCGGCCACCCAGTGCGGCTCCCTGATTGGGAAAGGCGG
GTGTAAGATCAAAGAGATCCGCGAGAGTACGGGGGCGCAGGTCCAGGTGG
CGGGGGATATGCTGCCCAACTCCACCGAGCGGGCCATCACCATCGCTGGC
GTGCCGCAGTCTGTCACCGAGTGTGTCAAGCAGATTTGCCTGGTCATGCT
GGAGACGCTCTCCCAGTCTCCGCAAGGGAGAGTCATGACCATTCCGTACC
AGCCCATGCCGGCCAGCTCCCCAGTCATCTGCGCGGGCGGCCAAGATCGG
TGCAGCGACGCTGCGGGCTACCCCCATGCCACCCATGACCTGGAGGGACC
ACCTCTAGATGCCTACTCGATTCAAGGACAACACACCATTTCTCCGCTCG
ATCTGGCCAAGCTGAACCAGGTGGCAAGACAACAGTCTCACTTTGCCATG
ATGCACGGCGGGACCGGATTCGCCGGAATTGACTCCAGCTCTCCAGAGGT
GAAAGGCTATTGGGCAAGTTTGGATGCATCTACTCAAACCACCCATGAAC
TCACCATTCCAAATAACTTAATTGGCTGCATAATCGGGCGCCAAGGCGCC
AACATTAATGAGATCCGCCAGATGTCCGGGGCCCAGATCAAAATTGCCAA
CCCAGTGGAAGGCTCCTCTGGTAGGCAGGTTACTATCACTGGCTCTGCTG
CCAGTATTAGTCTGGCCCAGTATCTAATCAATGCCAGGCTTTCCTCTGAG
AAGGGCATGGGGTGCAGCTACCCAACTTTCTTGTACAAAGTGGTGGTACC
TCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTC
CTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCG
GGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGA
CGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTT
GA
MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINIS
EGNCPERIITLTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTL
RLVVPATQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAG
VPQSVTECVKQICLVMLETLSQSPQGRVMTIPYQPMPASSPVICAGGQDR
CSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAM
MHGGTGFAGIDSSSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGA
NINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARLSSE
KGMGCSYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPA
GLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index