Stock Number Hs1551

Human Gene: TMOD3


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
TMOD3 tropomodulin 3 HGNC:11873 15q21.2 tmod 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03068 pGW-HA.attB ENST00000560549.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166213784937

Sequences

DNA sequence (1290 bp) Protein sequence (430 aa)
ATGGCACTGCCATTCCGTAAGGACTTAGAAAAGTACAAAGACCTTGATGA
AGATGAGCTCCTTGGGAATCTGTCAGAAACAGAACTGAAACAACTGGAAA
CTGTTTTGGATGATCTTGACCCCGAGAATGCCCTTCTGCCTGCAGGGTTC
CGGCAGAAGAACCAGACATCAAAGTCCACCACAGGGCCATTTGATAGAGA
GCATCTCCTTTCATATCTGGAGAAAGAAGCATTGGAGCATAAAGACAGGG
AAGACTATGTGCCCTACACTGGAGAAAAAAAAGGGAAAATATTTATCCCC
AAACAGAAACCTGTACAGACTTTTACAGAAGAAAAAGTGTCTCTTGATCC
AGAATTAGAAGAAGCTTTGACAAGTGCTTCTGATACAGAATTGTGTGACC
TCGCAGCAATTCTTGGGATGCACAATTTGATAACGAATACAAAGTTCTGT
AATATAATGGGAAGTAGTAATGGTGTTGACCAAGAACATTTTTCAAATGT
GGTCAAAGGTGAAAAGATTCTTCCGGTATTTGATGAGCCACCAAATCCAA
CCAATGTAGAAGAGAGTTTGAAGAGAACTAAAGAAAACGATGCTCATCTT
GTTGAAGTTAATTTGAATAATATAAAGAATATCCCAATTCCAACCCTAAA
AGATTTTGCAAAGGCTTTGGAAACCAACACACATGTGAAATGTTTCAGTC
TTGCAGCCACCCGGAGCAATGACCCTGTTGCTACTGCTTTTGCAGAAATG
CTGAAAGTGAACAAAACTTTGAAGAGCTTAAATGTGGAGTCCAACTTTAT
CACGGGAGTTGGGATTCTGGCACTGATTGATGCGTTAAGAGATAATGAAA
CCCTGGCAGAGCTCAAGATTGACAATCAGAGGCAGCAGTTGGGGACAGCT
GTAGAATTGGAAATGGCCAAGATGCTTGAGGAAAATACAAATATCCTTAA
ATTTGGATATCAGTTTACACAGCAGGGACCACGAACCAGAGCAGCTAATG
CTATAACAAAAAACAATGACTTAGTGCGTAAGAGACGAGTTGAAGGAGAT
CACCAGTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTA
TTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCG
GTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTAC
CCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTA
TGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MALPFRKDLEKYKDLDEDELLGNLSETELKQLETVLDDLDPENALLPAGF
RQKNQTSKSTTGPFDREHLLSYLEKEALEHKDREDYVPYTGEKKGKIFIP
KQKPVQTFTEEKVSLDPELEEALTSASDTELCDLAAILGMHNLITNTKFC
NIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRTKENDAHL
VEVNLNNIKNIPIPTLKDFAKALETNTHVKCFSLAATRSNDPVATAFAEM
LKVNKTLKSLNVESNFITGVGILALIDALRDNETLAELKIDNQRQQLGTA
VELEMAKMLEENTNILKFGYQFTQQGPRTRAANAITKNNDLVRKRRVEGD
HQYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIY
PYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index