Stock Number Hs1549

Human Gene: DNAJB2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
DNAJB2 DnaJ heat shock protein family (Hsp40) member B2 HGNC:5228 2q35 mrj 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02825 pGW-HA.attB ENST00000336576.9 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166213584936

Sequences

DNA sequence (1206 bp) Protein sequence (402 aa)
ATGGCATCCTACTACGAGATCCTAGACGTGCCGCGAAGTGCGTCCGCTGA
TGACATCAAGAAGGCGTATCGGCGCAAGGCTCTCCAGTGGCACCCAGACA
AAAACCCAGATAATAAAGAGTTTGCTGAGAAGAAATTTAAGGAGGTGGCC
GAGGCATATGAAGTGCTGTCTGACAAGCACAAGCGGGAGATTTACGACCG
CTATGGCCGGGAAGGGCTGACAGGGACAGGAACTGGCCCATCTCGGGCAG
AAGCTGGCAGTGGTGGGCCTGGCTTCACCTTCACCTTCCGCAGCCCCGAG
GAGGTCTTCCGGGAATTCTTTGGGAGTGGAGACCCTTTTGCAGAGCTCTT
TGATGACCTGGGCCCCTTCTCAGAGCTTCAGAACCGGGGTTCCCGACACT
CAGGCCCCTTCTTTACCTTCTCTTCCTCCTTCCCTGGGCACTCCGATTTC
TCCTCCTCATCTTTCTCCTTCAGTCCTGGGGCTGGTGCTTTTCGCTCTGT
TTCTACATCTACCACCTTTGTCCAAGGACGCCGCATCACCACACGCAGAA
TCATGGAGAACGGGCAGGAGCGGGTGGAAGTGGAGGAGGATGGGCAGCTG
AAGTCAGTCACAATCAATGGTGTCCCAGATGACCTGGCACTGGGCTTGGA
GCTGAGCCGTCGCGAGCAGCAGCCGTCAGTCACTTCCAGGTCTGGGGGCA
CTCAGGTCCAGCAGACCCCTGCCTCATGCCCCTTGGACAGCGACCTCTCT
GAGGATGAGGACCTGCAGCTGGCCATGGCCTACAGCCTGTCAGAGATGGA
GGCAGCTGGGAAGAAACCCGCAGGTGGGCGGGAGGCACAGCACCGACGGC
AGGGGCGGCCCAAGGCCCAGCACCAAGATCCAGGCTTGGGGGGGACCCAG
GAGGGTGCGAGGGGTGAAGCAACCAAACGCAGTCCATCCCCAGAGGAGAA
GGCCTCTCGCTGCCTCATCCTCTGCCCAACTTTCTTGTACAAAGTGGTGG
TACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGA
GCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACC
TGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCT
ATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTAC
GCTTGA
MASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVA
EAYEVLSDKHKREIYDRYGREGLTGTGTGPSRAEAGSGGPGFTFTFRSPE
EVFREFFGSGDPFAELFDDLGPFSELQNRGSRHSGPFFTFSSSFPGHSDF
SSSSFSFSPGAGAFRSVSTSTTFVQGRRITTRRIMENGQERVEVEEDGQL
KSVTINGVPDDLALGLELSRREQQPSVTSRSGGTQVQQTPASCPLDSDLS
EDEDLQLAMAYSLSEMEAAGKKPAGGREAQHRRQGRPKAQHQDPGLGGTQ
EGARGEATKRSPSPEEKASRCLILCPTFLYKVVVPRSSYSLLSIGTSILG
APSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDY
A*

Index