Stock Number Hs1548

Human Gene: RING1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
RING1 ring finger protein 1 HGNC:10018 6p21.32 Sce 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03815 pGW-HA.attB ENST00000374656.4 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166213484935

Sequences

DNA sequence (1452 bp) Protein sequence (484 aa)
ATGACGACGCCGGCGAATGCCCAGAATGCCAGCAAAACGTGGGAACTGAG
TCTGTATGAGCTGCACCGGACCCCGCAGGAAGCCATAATGGATGGCACAG
AGATTGCTGTTTCCCCTCGGTCACTGCATTCAGAACTCATGTGCCCTATC
TGCCTGGACATGCTGAAGAATACGATGACCACCAAGGAGTGCCTCCACAG
ATTCTGCTCTGACTGCATTGTCACAGCCCTACGGAGCGGGAACAAGGAGT
GTCCTACCTGCCGAAAGAAGCTGGTGTCCAAGCGATCCCTACGGCCAGAC
CCCAACTTTGATGCCCTGATCTCTAAGATCTATCCTAGCCGGGAGGAATA
CGAGGCCCATCAAGACCGAGTGCTTATCCGCCTGAGCCGCCTGCACAACC
AGCAGGCATTGAGCTCCAGCATTGAGGAGGGGCTACGCATGCAGGCCATG
CACAGGGCCCAGCGTGTGAGGCGGCCGATACCAGGGTCAGATCAGACCAC
AACGATGAGTGGGGGGGAAGGAGAGCCCGGGGAGGGAGAAGGGGATGGAG
AAGATGTGAGCTCAGACTCCGCCCCTGACTCTGCCCCAGGCCCTGCTCCC
AAGCGACCCCGTGGAGGGGGCGCAGGGGGGAGCAGTGTAGGGACAGGGGG
AGGCGGCACTGGTGGGGTGGGTGGGGGTGCCGGTTCGGAAGACTCTGGTG
ACCGGGGAGGGACTCTGGGAGGGGGAACGCTGGGCCCCCCAAGCCCTCCT
GGGGCCCCCAGCCCCCCAGAGCCAGGTGGAGAAATTGAGCTCGTGTTCCG
GCCCCACCCCCTGCTCGTGGAGAAGGGAGAATACTGCCAGACGAGGTATG
TGAAGACAACTGGGAATGCCACAGTGGACCACCTCTCCAAGTACTTGGCC
CTGCGCATTGCCCTCGAGCGGAGGCAACAGCAGGAAGCAGGGGAGCCAGG
AGGGCCTGGAGGGGGCGCCTCTGACACCGGAGGACCTGATGGGTGTGGCG
GGGAGGGTGGGGGTGCCGGAGGAGGTGACGGTCCTGAGGAGCCTGCTTTG
CCCAGCCTGGAGGGCGTCAGTGAAAAGCAGTACACCATCTACATCGCACC
TGGAGGCGGGGCGTTCACGACGTTGAATGGCTCGCTGACCCTGGAGCTGG
TGAATGAGAAATTCTGGAAGGTGTCCCGGCCACTGGAGCTGTGCTATGCT
CCCACCAAGGATCCAAAGTGCCCAACTTTCTTGTACAAAGTGGTGGTACC
TCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTC
CTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCG
GGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGA
CGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTT
GA
MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPI
CLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPD
PNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAM
HRAQRVRRPIPGSDQTTTMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAP
KRPRGGGAGGSSVGTGGGGTGGVGGGAGSEDSGDRGGTLGGGTLGPPSPP
GAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLA
LRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPAL
PSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYA
PTKDPKCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPA
GLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index