Stock Number Hs1546

Human Gene: BMI1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
BMI1 BMI1 proto-oncogene, polycomb ring finger HGNC:1066 10p12.2 Psc 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02938 pGW-HA.attB ENST00000376663.7 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166213284933

Sequences

DNA sequence (1212 bp) Protein sequence (404 aa)
ATGCATCGAACAACGAGAATCAAGATCACTGAGCTAAATCCCCACCTGAT
GTGTGTGCTTTGTGGAGGGTACTTCATTGATGCCACAACCATAATAGAAT
GTCTACATTCCTTCTGTAAAACGTGTATTGTTCGTTACCTGGAGACCAGC
AAGTATTGTCCTATTTGTGATGTCCAAGTTCACAAGACCAGACCACTACT
GAATATAAGGTCAGATAAAACTCTCCAAGATATTGTATACAAATTAGTTC
CAGGGCTTTTCAAAAATGAAATGAAGAGAAGAAGGGATTTTTATGCAGCT
CATCCTTCTGCTGATGCTGCCAATGGCTCTAATGAAGATAGAGGAGAGGT
TGCAGATGAAGATAAGAGAATTATAACTGATGATGAGATAATAAGCTTAT
CCATTGAATTCTTTGACCAGAACAGATTGGATCGGAAAGTAAACAAAGAC
AAAGAGAAATCTAAGGAGGAGGTGAATGATAAAAGATACTTACGATGCCC
AGCAGCAATGACTGTGATGCACTTAAGAAAGTTTCTCAGAAGTAAAATGG
ACATACCTAATACTTTCCAGATTGATGTCATGTATGAGGAGGAACCTTTA
AAGGATTATTATACACTAATGGATATTGCCTACATTTATACCTGGAGAAG
GAATGGTCCACTTCCATTGAAATACAGAGTTCGACCTACTTGTAAAAGAA
TGAAGATCAGTCACCAGAGAGATGGACTGACAAATGCTGGAGAACTGGAA
AGTGACTCTGGGAGTGACAAGGCCAACAGCCCAGCAGGAGGTATTCCCTC
CACCTCTTCTTGTTTGCCTAGCCCCAGTACTCCAGTGCAGTCTCCTCATC
CACAGTTTCCTCACATTTCCAGTACTATGAATGGAACCAGCAACAGCCCC
AGCGGTAACCACCAATCTTCTTTTGCCAATAGACCTCGAAAATCATCAGT
AAATGGGTCATCAGCAACTTCTTCTGGTTGCCTAACTTTCTTGTACAAAG
TGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATC
CTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGG
TGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCT
ATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCA
GATTACGCTTGA
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETS
KYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAA
HPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKD
KEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPL
KDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELE
SDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSP
SGNHQSSFANRPRKSSVNGSSATSSGCLTFLYKVVVPRSSYSLLSIGTSI
LGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVP
DYA*

Index