Stock Number Hs1545

Human Gene: PCGF2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
PCGF2 polycomb group ring finger 2 HGNC:12929 17q12 Su(z)2 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03131 pGW-HA.attB ENST00000620225.4 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166213184932

Sequences

DNA sequence (1266 bp) Protein sequence (422 aa)
ATGCATCGGACTACACGGATCAAAATCACAGAGCTGAACCCCCACCTCAT
GTGTGCCCTCTGCGGGGGGTACTTCATCGACGCCACCACTATCGTGGAGT
GCCTGCATTCCTTCTGCAAAACCTGCATCGTGCGCTACCTGGAGACCAAC
AAATACTGCCCCATGTGTGACGTGCAGGTCCATAAAACCCGGCCGCTGCT
GAGCATCAGGTCTGACAAAACACTTCAAGACATTGTCTACAAATTGGTCC
CTGGGCTTTTTAAAGATGAGATGAAACGGCGGCGGGATTTCTATGCAGCG
TACCCCCTGACGGAGGTCCCCAACGGCTCCAATGAGGACCGCGGCGAGGT
CTTGGAGCAGGAGAAGGGGGCTCTGAGTGATGATGAGATTGTCAGCCTCT
CCATCGAATTCTACGAAGGTGCCAGGGACCGGGACGAGAAGAAGGGCCCC
CTGGAGAATGGGGATGGGGACAAAGAGAAAACAGGGGTGCGCTTCCTGCG
ATGCCCAGCAGCCATGACCGTCATGCATCTTGCCAAGTTTCTCCGCAACA
AGATGGATGTGCCCAGCAAGTACAAGGTGGAGGTTCTGTACGAGGACGAG
CCACTGAAGGAATACTACACCCTCATGGACATCGCCTACATCTACCCCTG
GCGGCGGAACGGGCCTCTCCCCCTCAAGTACCGTGTCCAGCCAGCCTGCA
AGCGGCTCACCCTAGCCACGGTGCCCACCCCCTCCGAGGGCACCAACACC
AGCGGGGCGTCCGAGTGTGAGTCAGTCAGCGACAAGGCTCCCAGCCCTGC
CACCCTGCCAGCCACCTCCTCCTCCCTGCCCAGCCCAGCCACCCCATCCC
ATGGCTCTCCCAGTTCCCATGGGCCTCCAGCCACCCACCCTACCTCCCCC
ACTCCCCCTTCGACAGCCAGTGGGGCCACCACAGCTGCCAACGGGGGTAG
CTTGAACTGCCTGCAGACACCATCCTCCACCAGCAGGGGGCGCAAGATGA
CTGTCAACGGCGCTCCCGTGCCCCCCTTAACTTGCCCAACTTTCTTGTAC
AAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTC
CATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAG
CCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCG
GGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGT
TCCAGATTACGCTTGA
MHRTTRIKITELNPHLMCALCGGYFIDATTIVECLHSFCKTCIVRYLETN
KYCPMCDVQVHKTRPLLSIRSDKTLQDIVYKLVPGLFKDEMKRRRDFYAA
YPLTEVPNGSNEDRGEVLEQEKGALSDDEIVSLSIEFYEGARDRDEKKGP
LENGDGDKEKTGVRFLRCPAAMTVMHLAKFLRNKMDVPSKYKVEVLYEDE
PLKEYYTLMDIAYIYPWRRNGPLPLKYRVQPACKRLTLATVPTPSEGTNT
SGASECESVSDKAPSPATLPATSSSLPSPATPSHGSPSSHGPPATHPTSP
TPPSTASGATTAANGGSLNCLQTPSSTSRGRKMTVNGAPVPPLTCPTFLY
KVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYA
GYPYDVPDYAGSYPYDVPDYA*

Index