Stock Number Hs1544

Human Gene: ATCAY


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
ATCAY ATCAY, caytaxin HGNC:779 19p13.3 CG11593 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03249 pGW-HA.attB ENST00000450849.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166213084931

Sequences

DNA sequence (1347 bp) Protein sequence (449 aa)
ATGGGGACCACCGAAGCCACGCTCCGGATGGAAAACGTGGACGTGAAGGA
GGAATGGCAGGACGAAGATCTTCCCAGGCCACTCCCAGAAGAGACGGGGG
TGGAACTGCTTGGCAGCCCGGTGGAAGACACATCCTCTCCTCCCAACACG
CTAAATTTCAACGGAGCGCATCGTAAGAGGAAGACGCTGGTGGCCCCAGA
GATCAACATTTCTCTGGATCAGAGTGAGGGGTCCCTGCTGTCCGATGACT
TCTTGGATACCCCTGATGACCTGGATATTAACGTGGATGACATCGAGACC
CCCGATGAGACCGACTCGCTGGAGTTCCTGGGGAATGGCAACGAACTGGA
GTGGGAAGACGACACCCCCGTGGCCACCGCCAAGAACATGCCCGGGGACA
GCGCGGATCTATTTGGGGACGGCACGACGGAGGACGGCAGCGCCGCCAAC
GGGCGCCTGTGGCGGACAGTGATCATCGGGGAGCAAGAGCACCGTATAGA
CCTGCACATGATCCGGCCTTACATGAAAGTGGTCACCCACGGAGGGTACT
ACGGCGAAGGCCTCAACGCCATCATCGTCTTCGCAGCCTGCTTCCTTCCA
GACAGCAGCCTCCCCGACTACCACTACATCATGGAGAACCTCTTCCTGTA
CGTCATCAGCAGCTTAGAGCTCCTGGTGGCTGAGGACTACATGATCGTGT
ACCTGAACGGTGCCACGCCCCGGCGGAGGATGCCTGGAATCGGCTGGCTG
AAGAAGTGCTACCAGATGATCGACCGGAGGTTGCGGAAAAACCTGAAGTC
CTTGATCATCGTCCACCCCTCGTGGTTCATTCGGACTGTGCTGGCCATCT
CTCGCCCTTTCATCAGCGTCAAGTTCATCAACAAGATCCAGTACGTGCAC
AGCTTGGAAGACCTGGAGCAACTCATCCCTATGGAACACGTCCAGATCCC
AGACTGCGTCCTGCAATACGAAGAGGAAAGACTGAAGGCCAGGAGGGAGA
GCGCGAGGCCCCAGCCGGAGTTTGTGCTGCCCAGGTCTGAAGAGAAGCCA
GAGGTGGCACCAGTGGAAAACAGGTCTGCTCTGGTCTCAGAAGATCAGGA
AACAAGCATGTCCTGCCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAA
GTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCA
GGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTT
AATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCC
CGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MGTTEATLRMENVDVKEEWQDEDLPRPLPEETGVELLGSPVEDTSSPPNT
LNFNGAHRKRKTLVAPEINISLDQSEGSLLSDDFLDTPDDLDINVDDIET
PDETDSLEFLGNGNELEWEDDTPVATAKNMPGDSADLFGDGTTEDGSAAN
GRLWRTVIIGEQEHRIDLHMIRPYMKVVTHGGYYGEGLNAIIVFAACFLP
DSSLPDYHYIMENLFLYVISSLELLVAEDYMIVYLNGATPRRRMPGIGWL
KKCYQMIDRRLRKNLKSLIIVHPSWFIRTVLAISRPFISVKFINKIQYVH
SLEDLEQLIPMEHVQIPDCVLQYEEERLKARRESARPQPEFVLPRSEEKP
EVAPVENRSALVSEDQETSMSCPTFLYKVVVPRSSYSLLSIGTSILGAPS
GGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index