Stock Number Hs1543

Human Gene: RASSF7


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
RASSF7 Ras association domain family member 7 HGNC:1166 11p15.5 RASSF8 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03260 pGW-HA.attB ENST00000397583.7 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166212984930

Sequences

DNA sequence (1353 bp) Protein sequence (451 aa)
ATGTTGTTGGGACTGGCGGCCATGGAGCTGAAGGTGTGGGTGGATGGCAT
CCAGCGTGTGGTCTGTGGGGTCTCAGAGCAGACCACCTGCCAGGAAGTGG
TCATCGCACTAGCCCAAGCAATAGGCCAGACTGGCCGCTTTGTGCTTGTG
CAGCGGCTTCGGGAGAAGGAGCGGCAGTTGCTGCCACAAGAGTGTCCAGT
GGGCGCCCAGGCCACCTGCGGACAGTTTGCCAGCGATGTCCAGTTTGTCC
TGAGGCGCACAGGGCCCAGCCTAGCTGGGAGGCCCTCCTCAGACAGCTGT
CCACCCCCGGAACGCTGCCTAATTCGTGCCAGCCTCCCTGTAAAGCCACG
GGCTGCGCTGGGCTGTGAGCCCCGCAAAACACTGACCCCCGAGCCAGCCC
CCAGCCTCTCACGCCCTGGGCCTGCGGCCCCTGTGACACCCACACCAGGC
TGCTGCACAGACCTGCGGGGCCTGGAGCTCAGGGTGCAGAGGAATGCTGA
GGAGCTGGGCCATGAGGCCTTCTGGGAGCAAGAGCTGCGCCGGGAGCAGG
CCCGGGAGCGAGAGGGACAGGCACGCCTGCAGGCACTAAGTGCGGCCACT
GCTGAGCATGCCGCCCGGCTGCAGGCCCTGGACGCTCAGGCCCGTGCCCT
GGAGGCTGAGCTGCAGCTGGCAGCGGAGGCCCCTGGGCCCCCCTCACCTA
TGGCATCTGCCACTGAGCGCCTGCACCAGGACCTGGCTGTTCAGGAGCGG
CAGAGTGCGGAGGTGCAGGGCAGCCTGGCTCTGGTGAGCCGGGCCCTGGA
GGCAGCAGAGCGAGCCTTGCAGGCTCAGGCTCAGGAGCTGGAGGAGCTGA
ACCGAGAGCTCCGTCAGTGCAACCTGCAGCAGTTCATCCAGCAGACCGGG
GCTGCGCTGCCACCGCCCCCACGGCCTGACAGGGGCCCTCCTGGCACTCA
GGGCCCTCTGCCTCCAGCCAGAGAGGAGTCCCTCCTGGGCGCTCCCTCTG
AGTCCCATGCTGGTGCCCAGCCTAGGCCCCGAGGTGGCCCCCATGACGCA
GAACTCCTGGAGGTAGCAGCAGCTCCTGCCCCAGAGTGGTGTCCTCTGGC
AGCCCAGCCCCAGGCTCTGTTGCCAACTTTCTTGTACAAAGTGGTGGTAC
CTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCT
CCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGC
GGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATG
ACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCT
TGA
MLLGLAAMELKVWVDGIQRVVCGVSEQTTCQEVVIALAQAIGQTGRFVLV
QRLREKERQLLPQECPVGAQATCGQFASDVQFVLRRTGPSLAGRPSSDSC
PPPERCLIRASLPVKPRAALGCEPRKTLTPEPAPSLSRPGPAAPVTPTPG
CCTDLRGLELRVQRNAEELGHEAFWEQELRREQAREREGQARLQALSAAT
AEHAARLQALDAQARALEAELQLAAEAPGPPSPMASATERLHQDLAVQER
QSAEVQGSLALVSRALEAAERALQAQAQELEELNRELRQCNLQQFIQQTG
AALPPPPRPDRGPPGTQGPLPPAREESLLGAPSESHAGAQPRPRGGPHDA
ELLEVAAAPAPEWCPLAAQPQALLPTFLYKVVVPRSSYSLLSIGTSILGA
PSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA
*

Index