Stock Number Hs1542

Human Gene: CCNB2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CCNB2 cyclin B2 HGNC:1580 15q22.2 CycB 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03676 pGW-HA.attB ENST00000288207.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166212884929

Sequences

DNA sequence (1431 bp) Protein sequence (477 aa)
ATGGCGCTGCTCCGACGCCCGACGGTGTCCAGTGATTTGGAGAATATTGA
CACAGGAGTTAATTCTAAAGTTAAGAGTCATGTGACTATTAGGCGAACTG
TTTTAGAAGAAATTGGAAATAGAGTTACAACCAGAGCAGCACAAGTAGCT
AAGAAAGCTCAGAACACCAAAGTTCCAGTTCAACCCACCAAAACAACAAA
TGTCAACAAACAACTGAAACCTACTGCTTCTGTCAAACCAGTACAGATGG
AAAAGTTGGCTCCAAAGGGTCCTTCTCCCACACCTGAGGATGTCTCCATG
AAGGAAGAGAATCTCTGCCAAGCTTTTTCTGATGCCTTGCTCTGCAAAAT
CGAGGACATTGATAACGAAGATTGGGAGAACCCTCAGCTCTGCAGTGACT
ACGTTAAGGATATCTATCAGTATCTCAGGCAGCTGGAGGTTTTGCAGTCC
ATAAACCCACATTTCTTAGATGGAAGAGATATAAATGGACGCATGCGTGC
CATCCTAGTGGATTGGCTGGTACAAGTCCACTCCAAGTTTAGGCTTCTGC
AGGAGACTCTGTACATGTGCGTTGGCATTATGGATCGATTTTTACAGGTT
CAGCCAGTTTCCCGGAAGAAGCTTCAATTAGTTGGGATTACTGCTCTGCT
CTTGGCTTCCAAGTATGAGGAGATGTTTTCTCCAAATATTGAAGACTTTG
TTTACATCACAGACAATGCTTATACCAGTTCCCAAATCCGAGAAATGGAA
ACTCTAATTTTGAAAGAATTGAAATTTGAGTTGGGCCGACCCTTGCCACT
ACACTTCTTAAGGCGAGCATCAAAAGCCGGGGAGGTTGATGTTGAACAGC
ACACTTTAGCCAAGTATTTGATGGAGCTGACTCTCATCGACTATGATATG
GTGCATTATCATCCTTCTAAGGTAGCAGCAGCTGCTTCCTGCTTGTCTCA
GAAGGTTCTAGGACAAGGAAAATGGAACTTAAAGCAGCAGTATTACACAG
GATACACAGAGAATGAAGTATTGGAAGTCATGCAGCACATGGCCAAGAAT
GTGGTGAAAGTAAATGAAAACTTAACTAAATTCATCGCCATCAAGAATAA
GTATGCAAGCAGCAAACTCCTGAAGATCAGCATGATCCCTCAGCTGAACT
CAAAAGCCGTCAAAGACCTTGCCTCCCCACTGATAGGAAGGTCCGGCGAC
CCAGCTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACT
TAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTG
CTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGAT
GTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATC
CTATCCATATGACGTTCCAGATTACGCTTGA
MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVA
KKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSM
KEENLCQAFSDALLCKIEDIDNEDWENPQLCSDYVKDIYQYLRQLEVLQS
INPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQV
QPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREME
TLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLIDYDM
VHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKN
VVKVNENLTKFIAIKNKYASSKLLKISMIPQLNSKAVKDLASPLIGRSGD
PAFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYD
VPDYAGYPYDVPDYAGSYPYDVPDYA*

Index