Stock Number Hs1541

Human Gene: KCMF1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
KCMF1 potassium channel modulatory factor 1 HGNC:20589 2p11.2 Kcmf1 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03602 pGW-HA.attB ENST00000456682.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166212784928

Sequences

DNA sequence (1377 bp) Protein sequence (459 aa)
ATGTCCCGACATGAAGGTGTCAGCTGTGATGCATGTTTAAAAGGAAATTT
TCGAGGTCGCAGATATAAGTGTTTAATTTGCTACGATTACGATCTTTGTG
CATCTTGTTATGAAAGTGGTGCAACAACAACAAGGCATACAACTGACCAC
CCAATGCAGTGCATATTAACAAGGGTAGATTTTGATTTATACTATGGTGG
GGAAGCTTTCTCTGTAGAGCAGCCACAGTCTTTTACTTGTCCCTATTGTG
GAAAAATGGGCTATACGGAGACATCTCTTCAAGAACATGTTACTTCTGAA
CATGCAGAAACATCAACAGAAGTGATTTGTCCAATATGTGCAGCGTTACC
TGGAGGCGATCCTAATCATGTCACGGATGACTTTGCAGCTCATCTTACAC
TTGAACACAGAGCCCCTAGAGATTTAGATGAATCGAGTGGTGTTCGACAT
GTACGTAGAATGTTTCACCCTGGCCGGGGATTAGGAGGTCCTCGTGCTCG
TAGATCAAACATGCACTTTACTAGCAGTTCTACTGGTGGACTTTCTTCTT
CTCAGAGTTCATATTCTCCAAGCAATAGGGAAGCCATGGATCCTATAGCT
GAGCTTTTATCTCAGTTATCAGGAGTGAGACGTTCTGCAGGAGGACAGCT
TAATTCCTCTGGCCCTTCCGCTTCTCAGTTACAACAACTGCAGATGCAGC
TGCAGCTAGAACGGCAGCATGCCCAGGCAGCACGGCAACAACTGGAGACC
GCACGCAACGCAACCCGGCGTACTAACACAAGCAGTGTCACCACTACAAT
CACACAATCCACAGCAACAACCAACATAGCTAATACAGAAAGCAGTCAGC
AGACTCTACAGAATTCCCAGTTTCTTTTAACAAGGTTGAATGATCCTAAA
ATGTCTGAAACGGAGCGCCAGTCCATGGAAAGCGAGCGTGCAGACCGCAG
CCTGTTTGTCCAAGAGCTCCTTCTGTCCACTTTAGTGCGTGAAGAGAGCT
CATCCTCAGATGAGGATGATCGGGGGGAGATGGCAGATTTTGGTGCTATG
GGCTGTGTAGATATTATGCCTTTAGATGTTGCTTTAGAAAACCTAAATTT
AAAAGAGAGTAATAAAGGAAATGAGCCTCCACCACCTCCTCTTTGCCCAA
CTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGT
ATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGG
CGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTC
CTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTAT
CCATATGACGTTCCAGATTACGCTTGA
MSRHEGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTDH
PMQCILTRVDFDLYYGGEAFSVEQPQSFTCPYCGKMGYTETSLQEHVTSE
HAETSTEVICPICAALPGGDPNHVTDDFAAHLTLEHRAPRDLDESSGVRH
VRRMFHPGRGLGGPRARRSNMHFTSSSTGGLSSSQSSYSPSNREAMDPIA
ELLSQLSGVRRSAGGQLNSSGPSASQLQQLQMQLQLERQHAQAARQQLET
ARNATRRTNTSSVTTTITQSTATTNIANTESSQQTLQNSQFLLTRLNDPK
MSETERQSMESERADRSLFVQELLLSTLVREESSSSDEDDRGEMADFGAM
GCVDIMPLDVALENLNLKESNKGNEPPPPPLCPTFLYKVVVPRSSYSLLS
IGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSY
PYDVPDYA*

Index