Stock Number Hs1540

Human Gene: UBE2Z


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
UBE2Z ubiquitin conjugating enzyme E2 Z HGNC:25847 17q21.32 Bruce 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02159 pGW-HA.attB ENST00000511373.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166212684927

Sequences

DNA sequence (972 bp) Protein sequence (324 aa)
ATGTCCATTTATAAGGAGCCTCCTCCAGGAATGTTCGTTGTACCTGATAC
TGTTGACATGACTAAGATTCATGCATTGATCACAGGCCCATTTGACACTC
CTTATGAAGGGGGTTTCTTCCTGTTCGTGTTTCGGTGTCCGCCCGACTAT
CCCATCCACCCACCTCGGGTCAAACTGATGACAACGGGCAATAACACAGT
GAGGTTTAACCCCAACTTCTACCGCAATGGGAAAGTCTGCTTGAGTATTC
TAGGTACATGGACTGGACCTGCCTGGAGCCCAGCCCAGAGCATCTCCTCA
GTGCTCATCTCTATCCAGTCCCTGATGACTGAGAACCCCTATCACAATGA
GCCCGGCTTTGAACAGGAGAGACATCCAGGAGACAGCAAAAACTATAATG
AATGTATCCGGCACGAGACCATCAGAGTTGCAGTCTGTGACATGATGGAA
GGAAAGTGTCCCTGTCCTGAACCCCTACGAGGGGTGATGGAGAAGTCCTT
TCTGGAGTATTACGACTTCTATGAGGTGGCCTGCAAAGATCGCCTGCACC
TTCAAGGCCAAACTATGCAGGACCCTTTTGGAGAGAAGCGGGGCCACTTT
GACTACCAGTCCCTCTTGATGCGCCTGGGACTGATACGTCAGAAAGTGCT
GGAGAGGCTCCATAATGAGAATGCAGAAATGGACTCTGATAGCAGTTCAT
CTGGGACAGAGACAGACCTTCATGGGAGCCTGAGGGTTTACCCAACTTTC
TTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGG
AACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTG
GTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGAC
TATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATA
TGACGTTCCAGATTACGCTTGA
MSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDY
PIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISS
VLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMME
GKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHF
DYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRVYPTF
LYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPD
YAGYPYDVPDYAGSYPYDVPDYA*

Index