Stock Number Hs1539

Human Gene: CTSV


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CTSV cathepsin V HGNC:2538 9q22.33 Cp1 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02885 pGW-HA.attB ENST00000538255.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166212584926

Sequences

DNA sequence (1236 bp) Protein sequence (412 aa)
ATGAATCTTTCGCTCGTCCTGGCTGCCTTTTGCTTGGGAATAGCCTCCGC
TGTTCCAAAATTTGACCAAAATTTGGATACAAAGTGGTACCAGTGGAAGG
CAACACACAGAAGATTATATGGCGCGAATGAAGAAGGATGGAGGAGAGCA
GTGTGGGAAAAGAATATGAAAATGATTGAACTGCACAATGGGGAATACAG
CCAAGGGAAACATGGCTTCACAATGGCCATGAATGCTTTTGGTGACATGA
CCAATGAAGAATTCAGGCAGATGATGGGTTGCTTTCGAAACCAGAAATTC
AGGAAGGGGAAAGTGTTCCGTGAGCCTCTGTTTCTTGATCTTCCCAAATC
TGTGGATTGGAGAAAGAAAGGCTACGTGACGCCAGTGAAGAATCAGAAAC
AGTGTGGTTCTTGTTGGGCTTTTAGTGCGACTGGTGCTCTTGAAGGACAG
ATGTTCCGGAAAACTGGGAAACTTGTCTCACTGAGCGAGCAGAATCTGGT
GGACTGTTCGCGTCCTCAAGGCAATCAGGGCTGCAATGGTGGCTTCATGG
CTAGGGCCTTCCAGTATGTCAAGGAGAACGGAGGCCTGGACTCTGAGGAA
TCCTATCCATATGTAGCAGTGGATGAAATCTGTAAGTACAGACCTGAGAA
TTCTGTTGCTAATGACACTGGCTTCACAGTGGTCGCACCTGGAAAGGAGA
AGGCCCTGATGAAAGCAGTCGCAACTGTGGGGCCCATCTCCGTTGCTATG
GATGCAGGCCATTCGTCCTTCCAGTTCTACAAATCAGGCATTTATTTTGA
ACCAGACTGCAGCAGCAAAAACCTGGATCATGGTGTTCTGGTGGTTGGCT
ACGGCTTTGAAGGAGCAAATTCGAATAACAGCAAGTATTGGCTCGTCAAA
AACAGCTGGGGTCCAGAATGGGGCTCGAATGGCTATGTAAAAATAGCCAA
AGACAAGAACAACCACTGTGGAATCGCCACAGCAGCCAGCTACCCCAATG
TGTTGCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCT
CTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGC
TACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCAT
ACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCA
GGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MNLSLVLAAFCLGIASAVPKFDQNLDTKWYQWKATHRRLYGANEEGWRRA
VWEKNMKMIELHNGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGCFRNQKF
RKGKVFREPLFLDLPKSVDWRKKGYVTPVKNQKQCGSCWAFSATGALEGQ
MFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEE
SYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAM
DAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVK
NSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNVLPTFLYKVVVPRSSYS
LLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYA
GSYPYDVPDYA*

Index