Stock Number Hs1538

Human Gene: MOGAT2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
MOGAT2 monoacylglycerol O-acyltransferase 2 HGNC:23248 11q13.5 Dgat2 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02883 pGW-HA.attB ENST00000198801.9 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166212484925

Sequences

DNA sequence (1236 bp) Protein sequence (412 aa)
ATGGTAGAGTTCGCGCCCTTGTTTATGCCGTGGGAGCGCAGGCTGCAGAC
ACTTGCTGTCCTACAGTTTGTCTTCTCCTTCTTGGCACTGGCCGAGATCT
GCACTGTGGGCTTCATAGCCCTCCTGTTTACAAGATTCTGGCTCCTCACT
GTCCTGTATGCGGCCTGGTGGTATCTGGACCGAGACAAGCCACGGCAGGG
GGGCCGGCACATCCAGGCCATCAGGTGCTGGACTATATGGAAGTACATGA
AGGACTATTTCCCCATCTCGCTGGTCAAGACTGCTGAGCTGGACCCCTCT
CGGAACTACATTGCGGGCTTCCACCCCCATGGAGTCCTGGCAGTCGGAGC
CTTTGCCAACCTGTGCACTGAGAGCACAGGCTTCTCTTCGATCTTCCCCG
GTATCCGCCCCCATCTGATGATGCTGACCTTGTGGTTCCGGGCCCCCTTC
TTCAGAGATTACATCATGTCTGCAGGGTTGGTCACATCAGAAAAGGAGAG
TGCTGCTCACATTCTGAACAGGAAGGGTGGCGGAAACTTGCTGGGCATCA
TTGTAGGGGGTGCCCAGGAGGCCCTGGATGCCAGGCCTGGATCCTTCACG
CTGTTACTGCGGAACCGAAAGGGCTTCGTCAGGCTCGCCCTGACACACGG
GGCACCCCTGGTGCCAATCTTCTCCTTCGGGGAGAATGACCTATTTGACC
AGATTCCCAACTCTTCTGGCTCCTGGTTACGCTATATCCAGAATCGGTTG
CAGAAGATCATGGGCATCTCCCTCCCACTCTTTCATGGCCGTGGTGTCTT
CCAGTACAGCTTTGGTTTAATACCCTACCGCCGGCCCATCACCACTGTGG
TGGGGAAGCCCATCGAGGTACAGAAGACGCTGCATCCCTCGGAGGAGGAG
GTGAACCAGCTGCACCAGCGTTATATCAAAGAGCTGTGCAACCTCTTCGA
GGCCCACAAACTTAAGTTCAACATCCCTGCTGACCAGCACTTGGAGTTCT
GCTTGCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCT
CTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGC
TACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCAT
ACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCA
GGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MVEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLFTRFWLLT
VLYAAWWYLDRDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPS
RNYIAGFHPHGVLAVGAFANLCTESTGFSSIFPGIRPHLMMLTLWFRAPF
FRDYIMSAGLVTSEKESAAHILNRKGGGNLLGIIVGGAQEALDARPGSFT
LLLRNRKGFVRLALTHGAPLVPIFSFGENDLFDQIPNSSGSWLRYIQNRL
QKIMGISLPLFHGRGVFQYSFGLIPYRRPITTVVGKPIEVQKTLHPSEEE
VNQLHQRYIKELCNLFEAHKLKFNIPADQHLEFCLPTFLYKVVVPRSSYS
LLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYA
GSYPYDVPDYA*

Index