Stock Number Hs1537

Human Gene: HEY2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
HEY2 hes related family bHLH transcription factor with YRPW motif 2 HGNC:4881 6q22.31 Hey 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02893 pGW-HA.attB ENST00000368365.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK331662123

Sequences

DNA sequence (1245 bp) Protein sequence (415 aa)
ATGAAGCGCCCCTGCGAGGAGACGACCTCCGAGAGCGACATGGACGAGAC
CATCGACGTGGGGAGCGAGAACAATTACTCGGGGCAAAGTACTAGCTCTG
TGATTAGATTGAATTCTCCAACAACAACATCTCAGATTATGGCAAGAAAG
AAAAGGAGAGGGATTATAGAGAAAAGGCGTCGGGATCGGATAAATAACAG
TTTATCTGAGTTGAGAAGACTTGTGCCAACTGCTTTTGAAAAACAAGGAT
CTGCAAAGTTAGAAAAAGCTGAAATATTGCAAATGACAGTGGATCATTTG
AAGATGCTTCAGGCAACAGGGGGTAAAGGCTACTTTGACGCACACGCTCT
TGCCATGGACTTCATGAGCATAGGATTCCGAGAGTGCCTAACAGAAGTTG
CGCGGTACCTGAGCTCCGTGGAAGGCCTGGACTCCTCGGATCCGCTGCGG
GTGCGGCTTGTGTCTCATCTCAGCACTTGCGCCACCCAGCGGGAGGCGGC
GGCCATGACATCCTCCATGGCCCACCACCATCATCCGCTCCACCCGCATC
ACTGGGCCGCCGCCTTCCACCACCTGCCCGCAGCCCTGCTCCAGCCCAAC
GGCCTCCATGCCTCAGAGTCAACCCCTTGTCGCCTCTCCACAACTTCAGA
AGTGCCTCCTGCCCACGGCTCTGCTCTCCTCACGGCCACGTTTGCCCATG
CGGATTCAGCCCTCCGAATGCCATCCACGGGCAGCGTCGCCCCCTGCGTG
CCACCTCTCTCCACCTCTCTCTTGTCCCTCTCTGCCACCGTCCACGCCGC
AGCCGCAGCAGCCACCGCGGCTGCACACAGCTTCCCTCTGTCCTTCGCGG
GGGCATTCCCCATGCTTCCCCCAAACGCAGCAGCAGCAGTGGCCGCGGCC
ACAGCCATCAGCCCGCCCTTGTCAGTATCAGCCACGTCCAGTCCTCAGCA
GACCAGCAGTGGAACAAACAATAAACCTTACCGACCCTGGGGGACAGAAG
TTGGAGCTTTTTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGT
TCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGG
AGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAA
TTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCG
GACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARK
KRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHL
KMLQATGGKGYFDAHALAMDFMSIGFRECLTEVARYLSSVEGLDSSDPLR
VRLVSHLSTCATQREAAAMTSSMAHHHHPLHPHHWAAAFHHLPAALLQPN
GLHASESTPCRLSTTSEVPPAHGSALLTATFAHADSALRMPSTGSVAPCV
PPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPPNAAAAVAAA
TAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEVGAFYPTFLYKVVVPRS
SYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVP
DYAGSYPYDVPDYA*

Index