Stock Number Hs1536

Human Gene: NCK1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
NCK1 NCK adaptor protein 1 HGNC:7664 3q22.3 dock 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03384 pGW-HA.attB ENST00000288986.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166212284924

Sequences

DNA sequence (1365 bp) Protein sequence (455 aa)
ATGGCAGAAGAAGTGGTGGTAGTAGCCAAATTTGATTATGTGGCCCAACA
AGAACAAGAGTTGGACATCAAGAAGAATGAGAGATTATGGCTTCTGGATG
ATTCTAAGTCCTGGTGGCGAGTTCGAAATTCCATGAATAAAACAGGTTTT
GTGCCTTCTAACTATGTGGAAAGGAAAAACAGTGCTCGGAAAGCATCTAT
TGTGAAAAACCTAAAGGATACCTTAGGCATTGGAAAAGTGAAAAGAAAAC
CTAGTGTGCCAGATTCTGCATCTCCTGCTGATGATAGTTTTGTTGACCCA
GGGGAACGTCTCTATGACCTCAACATGCCCGCTTATGTGAAATTTAACTA
CATGGCTGAGAGAGAGGATGAATTATCATTGATAAAGGGGACAAAGGTGA
TCGTCATGGAGAAATGCAGTGATGGGTGGTGGCGTGGTAGCTACAATGGA
CAAGTTGGATGGTTCCCTTCAAACTATGTAACTGAAGAAGGTGACAGTCC
TTTGGGTGACCATGTGGGTTCTCTGTCAGAGAAATTAGCAGCAGTCGTCA
ATAACCTAAATACTGGGCAAGTGTTGCATGTGGTACAGGCTCTTTACCCA
TTCAGCTCATCTAATGATGAAGAACTTAATTTCGAGAAAGGAGATGTAAT
GGATGTTATTGAAAAACCTGAAAATGACCCAGAGTGGTGGAAATGCAGGA
AGATCAATGGTATGGTTGGTCTAGTACCAAAAAACTATGTTACCGTTATG
CAGAATAATCCATTAACTTCAGGTTTGGAACCATCACCTCCACAGTGTGA
TTACATTAGGCCTTCACTCACTGGAAAGTTTGCTGGCAATCCTTGGTATT
ATGGCAAAGTCACCAGGCATCAAGCAGAAATGGCATTAAATGAAAGAGGA
CATGAAGGGGATTTCCTCATTCGTGATAGTGAATCTTCGCCAAATGATTT
CTCAGTATCACTAAAAGCACAAGGGAAAAACAAGCATTTTAAAGTCCAAC
TAAAAGAGACTGTCTACTGCATTGGGCAGCGTAAATTCAGCACCATGGAA
GAACTTGTAGAACATTACAAAAAGGCACCAATTTTTACAAGTGAACAAGG
AGAAAAATTATATCTTGTCAAGCATTTATCATGCCCAACTTTCTTGTACA
AAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCC
ATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGC
CGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGG
GCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTT
CCAGATTACGCTTGA
MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGF
VPSNYVERKNSARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDP
GERLYDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNG
QVGWFPSNYVTEEGDSPLGDHVGSLSEKLAAVVNNLNTGQVLHVVQALYP
FSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPKNYVTVM
QNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG
HEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTME
ELVEHYKKAPIFTSEQGEKLYLVKHLSCPTFLYKVVVPRSSYSLLSIGTS
ILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDV
PDYA*

Index