Stock Number Hs1535

Human Gene: GDAP1L1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
GDAP1L1 ganglioside induced differentiation associated protein 1 like 1 HGNC:4213 20q13.12 Gdap1 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03331 pGW-HA.attB ENST00000342560.9 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166212184923

Sequences

DNA sequence (1335 bp) Protein sequence (445 aa)
ATGGCGACCCCCAACAATCTGACCCCCACCAACTGCAGCTGGTGGCCCAT
CTCCGCGCTGGAGAGCGATGCGGCCAAGCCAGCGGAGGCCCCCGACGCTC
CCGAGGCGGCCAGCCCCGCCCATTGGCCCAGGGAGAGCCTGGTTCTGTAC
CACTGGACCCAGTCCTTCAGCTCGCAGAAGGTGCGGCTGGTGATCGCCGA
GAAGGGCCTGGTGTGCGAGGAGCGGGACGTGAGCCTGCCACAGAGCGAGC
ACAAGGAGCCCTGGTTCATGCGGCTCAACCTGGGCGAGGAGGTGCCCGTC
ATCATCCACCGCGACAACATCATCAGTGACTATGACCAGATCATTGACTA
TGTGGAGCGCACCTTCACAGGAGAGCACGTGGTGGCCCTGATGCCCGAGG
TGGGCAGCCTGCAGCACGCACGGGTGCTGCAGTACCGGGAGCTGCTGGAC
GCACTGCCCATGGATGCCTACACGCATGGCTGCATCCTGCATCCCGAGCT
CACCACCGACTCCATGATCCCCAAGTACGCCACGGCCGAGATCCGCAGAC
ATTTAGCCAATGCCACCACGGACCTCATGAAACTGGACCATGAAGAGGAG
CCCCAGCTCTCCGAGCCCTACCTTTCTAAACAAAAGAAGCTCATGGCCAA
GATCTTGGAGCATGATGATGTGAGCTACCTGAAGAAGATCCTCGGGGAAC
TGGCCATGGTGCTGGACCAGATTGAGGCGGAGCTGGAGAAGAGGAAGCTG
GAGAACGAGGGGCAGAAATGCGAGCTGTGGCTCTGTGGCTGTGCCTTCAC
CCTCGCTGATGTCCTCCTGGGAGCCACCCTGCACCGCCTCAAGTTCCTGG
GACTGTCCAAGAAATACTGGGAAGATGGCAGCCGGCCCAACCTGCAGTCC
TTCTTTGAGAGGGTCCAGAGACGCTTTGCCTTCCGGAAAGTCCTGGGTGA
CATCCACACCACCCTGCTGTCGGCCGTCATCCCCAATGCTTTCCGGCTGG
TCAAGAGGAAACCCCCATCCTTCTTCGGGGCGTCCTTCCTCATGGGCTCC
CTGGGTGGGATGGGCTACTTTGCCTACTGGTACCTCAAGAAAAAATACAT
CTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTC
TACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCT
ACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATA
CGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAG
GATCCTATCCATATGACGTTCCAGATTACGCTTGA
MATPNNLTPTNCSWWPISALESDAAKPAEAPDAPEAASPAHWPRESLVLY
HWTQSFSSQKVRLVIAEKGLVCEERDVSLPQSEHKEPWFMRLNLGEEVPV
IIHRDNIISDYDQIIDYVERTFTGEHVVALMPEVGSLQHARVLQYRELLD
ALPMDAYTHGCILHPELTTDSMIPKYATAEIRRHLANATTDLMKLDHEEE
PQLSEPYLSKQKKLMAKILEHDDVSYLKKILGELAMVLDQIEAELEKRKL
ENEGQKCELWLCGCAFTLADVLLGATLHRLKFLGLSKKYWEDGSRPNLQS
FFERVQRRFAFRKVLGDIHTTLLSAVIPNAFRLVKRKPPSFFGASFLMGS
LGGMGYFAYWYLKKKYIYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGA
TAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index