Stock Number Hs1534

Human Gene: RIBC1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
RIBC1 RIB43A domain with coiled-coils 1 HGNC:26537 Xp11.22 CG7264 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03287 pGW-HA.attB ENST00000375327.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166212084922

Sequences

DNA sequence (1371 bp) Protein sequence (457 aa)
ATGTATAACATAAAACAGTCAACAGATACCAAGGAAGCAGCAGCCATCGA
GGCTAGAAGAAATCGAGAAAAAGAGCGACAAAACCGATTCTTCAATGTGC
GGAACCGAGTCATGGGGGTGGATGTCCAGGCCCTGAACAACCAGGTGGGA
GACCGAAAGCGTCGGGAAGCAGCAGAAAGAAGCAAGGAGGCAGCTTATGG
TACCAGCCAGGTGCAGTATGATGTGGTAGTCCAGATGTTAGAGAAGGAAG
AGGCAGATCGAACACGTCAGCTGGCCAAGAAAGTCCAGGAGTTTCGGGAG
CAGAAGCAGCAGCTCAAGAACGGGCGTGAATTTAGTCTTTGGGATCCAGG
CCAAGTCTGGAAGGGGCTTCCAACCTATCTTAGTTACAGTAATACCTATC
CTGGTCCAGCCAGCCTGCAGTACTTCTCTGGGGAAGACCTAGACAGGGAC
ACACGGCTGAGAATGCAGCAGGGGCAGTTCAGGTACAACTTGGAAAGGCA
ACAGCAGGAGCAACAGCAAGCCAAGGTTGATGAGAATTATACAGATGCGC
TCAGTAACCAGCTGCGCCTCGCCATGGATGCACAGGCCACCCATCTGGCC
AGGCTGGAGGAGTCCTGTCGTGCGGCCATGATGTGTGCCATGGCCAACGC
CAACAAAGCGCAGGCAGCTGTGCAGGCTGGGCGTCAGCGCTGTGAGCGTC
AGCGTGAACAGAAGGCCAACCTTGCGGAGATCCAGCACCAGAGCACGAGT
GACCTACTGACTGAAAACCCCCAGGTCGCCCAACACCCTATGGCTCCCTA
CCGGGTCCTGCCCTATTGCTGGAAGGGCATGACTCCAGAGCAGCAAGCTG
CCATCAGGAAAGAGCAGGAAGTACAACGCTCTAAGAAGCAAGCACACCGT
CAGGCTGAGAAAACACTGGATACTGAATGGAAAAGCCAGACTATGAGCTC
AGCCCAGGCAGTGCTGGAGCTAGAAGAGCAGGAGAGGGAATTGTGTGCTG
TATTTCAAAGGGGTCTAGGATCCTTCAACCAGCAGCTGGCTAATGAGCAA
AAAGCCCAGCAGGATTACCTGAATTCAGTAATCTACACCAATCAACCTAC
AGCCCAGTATCACCAGCAGTTTAACACCAGCAGCCGCTACCCAACTTTCT
TGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGA
ACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGG
TGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACT
ATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATAT
GACGTTCCAGATTACGCTTGA
MYNIKQSTDTKEAAAIEARRNREKERQNRFFNVRNRVMGVDVQALNNQVG
DRKRREAAERSKEAAYGTSQVQYDVVVQMLEKEEADRTRQLAKKVQEFRE
QKQQLKNGREFSLWDPGQVWKGLPTYLSYSNTYPGPASLQYFSGEDLDRD
TRLRMQQGQFRYNLERQQQEQQQAKVDENYTDALSNQLRLAMDAQATHLA
RLEESCRAAMMCAMANANKAQAAVQAGRQRCERQREQKANLAEIQHQSTS
DLLTENPQVAQHPMAPYRVLPYCWKGMTPEQQAAIRKEQEVQRSKKQAHR
QAEKTLDTEWKSQTMSSAQAVLELEEQERELCAVFQRGLGSFNQQLANEQ
KAQQDYLNSVIYTNQPTAQYHQQFNTSSRYPTFLYKVVVPRSSYSLLSIG
TSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPY
DVPDYA*

Index