Stock Number Hs1533

Human Gene: TRAM1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
TRAM1 translocation associated membrane protein 1 HGNC:20568 8q13.3 TRAM X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03269 pGW-HA.attB ENST00000262213.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166211984921

Sequences

DNA sequence (1356 bp) Protein sequence (452 aa)
ATGGCGATTCGCAAGAAAAGCACCAAGAGCCCCCCAGTGCTGAGCCACGA
ATTCGTCCTGCAGAATCACGCGGACATCGTCTCCTGTGTGGCGATGGTCT
TCCTGCTGGGGCTCATGTTTGAGATAACGGCAAAAGCTTCTATCATTTTT
GTTACTCTTCAGTACAATGTCACCCTCCCAGCAACAGAAGAACAAGCTAC
TGAATCAGTGTCCCTTTATTACTATGGCATCAAAGATTTGGCTACTGTTT
TCTTCTACATGCTAGTGGCGATAATTATTCATGCCGTAATTCAAGAGTAT
ATGTTGGATAAAATTAACAGGCGAATGCACTTCTCCAAAACAAAACACAG
CAAGTTTAATGAATCTGGTCAGCTTAGTGCGTTCTACCTTTTTGCCTGTG
TTTGGGGCACATTCATTCTCATCTCTGAAAACTACATCTCAGACCCAACT
ATCTTATGGAGGGCTTATCCCCATAACCTGATGACATTTCAAATGAAGTT
TTTCTACATATCACAGCTGGCTTACTGGCTTCATGCTTTTCCTGAACTCT
ACTTCCAGAAAACCAAAAAAGAAGATATTCCTCGTCAGCTTGTCTACATT
GGTCTTTACCTCTTCCACATTGCTGGAGCTTACCTTTTGAACTTGAATCA
TCTAGGACTTGTTCTTCTGGTGCTACATTATTTTGTTGAATTTCTTTTCC
ACATTTCCCGCCTGTTTTATTTTAGCAATGAAAAGTATCAGAAAGGATTT
TCTCTGTGGGCAGTTCTTTTTGTTTTGGGAAGACTTCTGACTTTAATTCT
TTCAGTACTGACTGTTGGTTTTGGCCTTGCAAGAGCAGAAAATCAGAAGC
TGGATTTCAGTACTGGAAACTTCAATGTGTTAGCTGTTAGAATCGCTGTT
CTGGCATCCATTTGCGTTACTCAGGCATTTATGATGTGGAAGTTCATTAA
TTTTCAGCTTCGAAGGTGGAGGGAACATTCTGCTTTTCAGGCACCAGCTG
TGAAGAAGAAACCAACAGTAACTAAAGGCAGATCTTCTAAAAAAGGAACA
GAAAATGGTGTGAATGGAACATTAACTTCAAATGTAGCAGACTCTCCCCG
GAATAAAAAAGAGAAATCTTCATACCCAACTTTCTTGTACAAAGTGGTGG
TACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGA
GCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACC
TGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCT
ATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTAC
GCTTGA
MAIRKKSTKSPPVLSHEFVLQNHADIVSCVAMVFLLGLMFEITAKASIIF
VTLQYNVTLPATEEQATESVSLYYYGIKDLATVFFYMLVAIIIHAVIQEY
MLDKINRRMHFSKTKHSKFNESGQLSAFYLFACVWGTFILISENYISDPT
ILWRAYPHNLMTFQMKFFYISQLAYWLHAFPELYFQKTKKEDIPRQLVYI
GLYLFHIAGAYLLNLNHLGLVLLVLHYFVEFLFHISRLFYFSNEKYQKGF
SLWAVLFVLGRLLTLILSVLTVGFGLARAENQKLDFSTGNFNVLAVRIAV
LASICVTQAFMMWKFINFQLRRWREHSAFQAPAVKKKPTVTKGRSSKKGT
ENGVNGTLTSNVADSPRNKKEKSSYPTFLYKVVVPRSSYSLLSIGTSILG
APSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDY
A*

Index