Stock Number Hs1532

Human Gene: ACTG1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
ACTG1 actin gamma 1 HGNC:144 17q25.3 Act5C X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03272 pGW-HA.attB ENST00000570382.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166211884920

Sequences

DNA sequence (1359 bp) Protein sequence (453 aa)
ATGGAAGAAGAGATCGCCGCGCTGGTCATTGACAATGGCTCCGGCATGTG
CAAAGCTGGTTTTGCTGGGGACGACGCTCCCCGAGCCGTGTTTCCTTCCA
TCGTCGGGCGCCCCAGACACCAGGGCGTCATGGTGGGCATGGGCCAGAAG
GACTCCTACGTGGGCGACGAGGCCCAGAGCAAGCGTGGCATCCTGACCCT
GAAGTACCCCATTGAGCATGGCATCGTCACCAACTGGGACGACATGGAGA
AGATCTGGCACCACACCTTCTACAACGAGCTGCGCGTGGCCCCGGAGGAG
CACCCAGTGCTGCTGACCGAGGCCCCCCTGAACCCCAAGGCCAACAGAGA
GAAGATGACTCAGATTATGTTTGAGACCTTCAACACCCCGGCCATGTACG
TGGCCATCCAGGCCGTGCTGTCCCTCTACGCCTCTGGGCGCACCACTGGC
ATTGTCATGGACTCTGGAGACGGGGTCACCCACACGGTGCCCATCTACGA
GGGCTACGCCCTCCCCCACGCCATCCTGCGTCTGGACCTGGCTGGCCGGG
ACCTGACCGACTACCTCATGAAGATCCTCACTGAGCGAGGCTACAGCTTC
ACCACCACGGCCGAGCGGGAAATCGTGCGCGACATCAAGGAGAAGCTGTG
CTACGTCGCCCTGGACTTCGAGCAGGAGATGGCCACCGCCGCATCCTCCT
CTTCTCTGGAGAAGAGCTACGAGCTGCCCGATGGCCAGGTCATCACCATT
GGCAATGAGCGGTTCCGGTGTCCGGAGGCGCTGTTCCAGCCTTCCTTCCT
GGGTATGGAATCTTGCGGCATCCACGAGACCACCTTCAACTCCATCATGA
AGTGTGACGTGGACATCCGCAAAGACCTGTACGCCAACACGGTGCTGTCG
GGCGGCACCACCATGTATCCGGGCATTGCTGACAGGATGCAGAAGGAGAT
CACCGCCCTGGCGCCCAGCACCATGAAGATCAAGATCATCGCACCCCCAG
AGCGCAAGTACTCGGTGTGGATCGGTGGCTCCATCCTGGCCTCACTGTCC
ACCTTCCAGCAGATGTGGATTAGCAAGCAGGAGTACGACGAGTCGGGCCC
CTCCATCGTCCACCGCAAATGCTTCTACCCAACTTTCTTGTACAAAGTGG
TGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTT
GGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGG
ACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATC
CCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGAT
TACGCTTGA
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK
DSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE
HPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTG
IVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSF
TTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITI
GNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLS
TFQQMWISKQEYDESGPSIVHRKCFYPTFLYKVVVPRSSYSLLSIGTSIL
GAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPD
YA*

Index