Stock Number Hs1531

Human Gene: CCNJ


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CCNJ cyclin J HGNC:23434 10q24.1 CycJ 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03258 pGW-HA.attB ENST00000265992.9 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166211784919

Sequences

DNA sequence (1350 bp) Protein sequence (450 aa)
ATGGAGCTGGAGGGGCAGTGGTGGCGAGGACAGCTGGCCGCCGATATTCA
CCAAGCGCTTCGCTACAAGGAGCTGAAGTTGCCCTCCTATAAAGGCCAGT
CCCCTCAGTTAAGTCTCAGACGGTATTTTGCTGACTTGATTGCCATTGTG
AGCAATCGCTTCACACTCTGCCCTTCTGCCCGCCATCTTGCTGTCTATTT
ACTGGACCTGTTTATGGACCGCTATGACATCTCTATCCAGCAGCTGCATT
TAGTTGCGCTTTCCTGCCTGCTTCTAGCAAGTAAATTTGAAGAAAAAGAA
GACAGTGTGCCTAAGCTGGAGCAGCTCAACAGCCTGGGTTGTATGACTAA
TATGAATCTAGTATTAACAAAACAAAATTTGCTACATATGGAACTATTAT
TATTAGAAACCTTTCAGTGGAACCTCTGCCTTCCAACAGCCGCCCATTTC
ATTGAGTATTATCTCTCTGAAGCAGTACACGAAACAGATCTTCATGACGG
CTGGCCAATGATTTGCTTGGAAAAGACTAAACTCTACATGGCCAAATATG
CAGATTACTTCCTGGAAGTATCTTTGCAAGTAGCTGCTGCATGTGTGGCT
TCTTCGAGGATTATACTTCGTCTTTCTCCAACGTGGCCTACAAGACTACA
TCGTCTTACTGCCTACTCTTGGGATTTCTTAGTGCAGTGTATTGAACGAC
TGTTGATCGCTCATGATAATGATGTGAAAGAAGCAAACAAACAGAGAGGG
CAAGCAGGACCTCAGTCAGCGCAACTAAGTGTATTCCAGACAGCCTCCCA
GCCATCACGGCCAGTTCACTTTCAGCAACCTCAGTATCTCCATCAGACAC
ATCAGACCTCACTGCAGTATCGCCATCCTACGTCAGAACAACCAAGCTGT
CAGCAGATTGTATCGACCACACACACCTCATCTTACACACTACAGACATG
TCCTGCTGGCTTCCAAACTAGTGTTCAGGGCCTTGGGCACATGCAGACTG
GTGTTGGGATGTCACTGGCAATACCAGTAGAAGTTAAGCCCTGTCTGAGT
GTTTCTTACAACCGGAGTTATCAGATAAATGAACATTACCCTTGTATTAC
TCCATGTTTTGAAAGGTGCCCAACTTTCTTGTACAAAGTGGTGGTACCTC
GAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCT
TCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGG
GTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACG
TCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MELEGQWWRGQLAADIHQALRYKELKLPSYKGQSPQLSLRRYFADLIAIV
SNRFTLCPSARHLAVYLLDLFMDRYDISIQQLHLVALSCLLLASKFEEKE
DSVPKLEQLNSLGCMTNMNLVLTKQNLLHMELLLLETFQWNLCLPTAAHF
IEYYLSEAVHETDLHDGWPMICLEKTKLYMAKYADYFLEVSLQVAAACVA
SSRIILRLSPTWPTRLHRLTAYSWDFLVQCIERLLIAHDNDVKEANKQRG
QAGPQSAQLSVFQTASQPSRPVHFQQPQYLHQTHQTSLQYRHPTSEQPSC
QQIVSTTHTSSYTLQTCPAGFQTSVQGLGHMQTGVGMSLAIPVEVKPCLS
VSYNRSYQINEHYPCITPCFERCPTFLYKVVVPRSSYSLLSIGTSILGAP
SGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index