Stock Number Hs1530

Human Gene: GFI1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
GFI1 growth factor independent 1 transcriptional repressor HGNC:4237 1p22.1 sens-2 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03885 pGW-HA.attB ENST00000370332.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166211684918

Sequences

DNA sequence (1503 bp) Protein sequence (501 aa)
ATGCCGCGCTCATTTCTCGTCAAAAGCAAGAAGGCTCACAGCTACCACCA
GCCGCGCTCCCCAGGACCAGACTATTCCCTCCGTTTAGAGAATGTACCGG
CGCCTAGCCGAGCAGACAGCACTTCAAATGCAGGCGGGGCGAAGGCGGAG
CCCCGGGACCGTTTGTCCCCCGAATCGCAGCTGACCGAAGCCCCAGACAG
AGCCTCCGCATCCCCAGACAGCTGCGAAGGCAGCGTCTGCGAACGGAGCT
CGGAGTTTGAGGACTTCTGGAGGCCCCCGTCACCCTCCGCGTCTCCAGCC
TCGGAGAAGTCAATGTGCCCATCGCTGGACGAAGCCCAGCCCTTCCCCCT
GCCTTTCAAACCGTACTCATGGAGCGGCCTGGCGGGTTCTGACCTGCGGC
ACCTGGTGCAGAGCTACCGACCGTGTGGGGCCCTGGAGCGTGGCGCTGGC
CTGGGCCTCTTCTGTGAACCCGCCCCGGAGCCTGGCCACCCGGCCGCGCT
GTACGGCCCGAAGCGGGCTGCCGGCGGCGCGGGGGCCGGGGCGCCAGGGA
GCTGCAGCGCAGGGGCCGGTGCCACCGCTGGCCCTGGCCTAGGGCTCTAC
GGCGACTTCGGGTCTGCGGCAGCCGGGCTGTATGAGAGGCCCACGGCAGC
GGCGGGCTTGCTGTACCCCGAGCGTGGCCACGGGCTGCACGCAGACAAGG
GCGCTGGCGTCAAGGTGGAGTCGGAGCTGCTGTGCACCCGCCTGCTGCTG
GGCGGCGGCTCCTACAAGTGCATCAAGTGCAGCAAGGTGTTCTCCACGCC
GCACGGGCTCGAGGTGCACGTGCGCAGGTCCCACAGCGGTACCAGACCCT
TTGCCTGCGAGATGTGCGGCAAGACCTTCGGGCACGCGGTGAGCCTGGAG
CAGCACAAAGCCGTGCACTCGCAGGAACGGAGCTTTGACTGTAAGATCTG
TGGGAAGAGCTTCAAGAGGTCATCCACACTGTCCACACACCTGCTTATCC
ACTCAGACACTCGGCCCTACCCCTGTCAGTACTGTGGCAAGAGGTTCCAC
CAGAAGTCAGACATGAAGAAACACACTTTCATCCACACTGGTGAGAAGCC
TCACAAGTGCCAGGTGTGCGGCAAGGCATTCAGCCAGAGCTCCAACCTCA
TCACCCACAGCCGCAAACACACAGGCTTCAAGCCCTTCGGCTGCGACCTC
TGTGGGAAGGGTTTCCAGAGGAAGGTGGACCTCCGAAGGCACCGGGAGAC
GCAGCATGGGCTCAAATTGGACCCAGCTTTCTTGTACAAAGTGGTGGTAC
CTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCT
CCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGC
GGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATG
ACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCT
TGA
MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAE
PRDRLSPESQLTEAPDRASASPDSCEGSVCERSSEFEDFWRPPSPSASPA
SEKSMCPSLDEAQPFPLPFKPYSWSGLAGSDLRHLVQSYRPCGALERGAG
LGLFCEPAPEPGHPAALYGPKRAAGGAGAGAPGSCSAGAGATAGPGLGLY
GDFGSAAAGLYERPTAAAGLLYPERGHGLHADKGAGVKVESELLCTRLLL
GGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLE
QHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFH
QKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDL
CGKGFQRKVDLRRHRETQHGLKLDPAFLYKVVVPRSSYSLLSIGTSILGA
PSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA
*

Index