Stock Number Hs1529

Human Gene: CPA4


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CPA4 carboxypeptidase A4 HGNC:15740 7q32.2 CG3097 X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03884 pGW-HA.attB ENST00000493259.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166211584917

Sequences

DNA sequence (1497 bp) Protein sequence (499 aa)
ATGAGGTGGATACTGTTCATTGGGGCCCTTATTGGGTCCAGCATCTGTGG
CCAAGAAAAATTTTTTGGGGACCAAGTTTTGAGGATTAATGTCAGAAATG
GAGACGAGATCAGCAAATTGAGTCAACTAGTGAATTCAAACAACTTGAAG
CTCAATTTCTGGAAATCTCCCTCCTCCTTCAATCGGCCTGTGGATGTCCT
GGTCCCATCTGTCAGTCTGCAGGCATTTAAATCCTTCCTGAGATCCCAGG
GCTTAGAGTACGCAGTGACAATTGAGGACCTGCAGGCCCTTTTAGACAAT
GAAGATGATGAAATGCAACACAATGAAGGGCAAGAACGGAGCAGTAATAA
CTTCAACTACGGGGCTTACCATTCCCTGGAAGCTATTTACCACGAGATGG
ACAACATTGCCGCAGACTTTCCTGACCTGGCGAGGAGGGTGAAGATTGGA
CATTCGTTTGAAAACCGGCCGATGTATGTACTGAAGTTCAGCACTGGGAA
AGGCGTGAGGCGGCCGGCCGTTTGGCTGAATGCAGGCATCCATTCCCGAG
AGTGGATCTCCCAGGCCACTGCAATCTGGACGGCAAGGAAGATTGTATCT
GATTACCAGAGGGATCCAGCTATCACCTCCATCTTGGAGAAAATGGATAT
TTTCTTGTTGCCTGTGGCCAATCCTGATGGATATGTGTATACTCAAACTC
AAAACCGATTATGGAGGAAGACGCGGTCCCGAAATCCTGGAAGCTCCTGC
ATTGGTGCTGACCCAAATAGAAACTGGAACGCTAGTTTTGCAGGAAAGGG
AGCCAGCGACAACCCTTGCTCCGAAGTGTACCATGGACCCCACGCCAATT
CGGAAGTGGAGGTGAAATCAGTGGTAGATTTCATCCAAAAACATGGGAAT
TTCAAGGGCTTCATCGACCTGCACAGCTACTCGCAGCTGCTGATGTATCC
ATATGGGTACTCAGTCAAAAAGGCCCCAGATGCCGAGGAACTCGACAAGG
TGGCGAGGCTTGCGGCCAAAGCTCTGGCTTCTGTGTCGGGCACTGAGTAC
CAAGTGGGTCCCACCTGCACCACTGTCTATCCAGCTAGCGGGAGCAGCAT
CGACTGGGCGTATGACAACGGCATCAAATTTGCATTCACATTTGAGTTGA
GAGATACCGGGACTTATGGCTTCCTCCTGCCAGCTAACCAGATCATCCCC
ACTGCAGAGGAGACGTGGCTGGGGCTGAAGACCATCATGGAGCATGTGCG
GGACAACCTCTACTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAA
GTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCA
GGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTT
AATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCC
CGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MRWILFIGALIGSSICGQEKFFGDQVLRINVRNGDEISKLSQLVNSNNLK
LNFWKSPSSFNRPVDVLVPSVSLQAFKSFLRSQGLEYAVTIEDLQALLDN
EDDEMQHNEGQERSSNNFNYGAYHSLEAIYHEMDNIAADFPDLARRVKIG
HSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVS
DYQRDPAITSILEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPGSSC
IGADPNRNWNASFAGKGASDNPCSEVYHGPHANSEVEVKSVVDFIQKHGN
FKGFIDLHSYSQLLMYPYGYSVKKAPDAEELDKVARLAAKALASVSGTEY
QVGPTCTTVYPASGSSIDWAYDNGIKFAFTFELRDTGTYGFLLPANQIIP
TAEETWLGLKTIMEHVRDNLYYPTFLYKVVVPRSSYSLLSIGTSILGAPS
GGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index