Stock Number Hs1528

Human Gene: KLF15


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
KLF15 Kruppel like factor 15 HGNC:14536 3q21.3 Klf15 X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03861 pGW-HA.attB ENST00000296233.3 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166211484916

Sequences

DNA sequence (1482 bp) Protein sequence (494 aa)
ATGGTGGACCACTTACTTCCAGTGGACGAGAACTTCTCGTCGCCAAAATG
CCCAGTTGGGTATCTGGGTGATAGGCTGGTTGGCCGGCGGGCATATCACA
TGCTGCCCTCACCCGTCTCTGAAGATGACAGCGATGCCTCCAGCCCCTGC
TCCTGTTCCAGTCCCGACTCTCAAGCCCTCTGCTCCTGCTATGGTGGAGG
CCTGGGCACCGAGAGCCAGGACAGCATCTTGGACTTCCTATTGTCCCAGG
CCACGCTGGGCAGTGGCGGGGGCAGCGGCAGTAGCATTGGGGCCAGCAGT
GGCCCCGTGGCCTGGGGGCCCTGGCGAAGGGCAGCGGCCCCTGTGAAGGG
GGAGCATTTCTGCTTGCCCGAGTTTCCTTTGGGTGATCCTGATGACGTCC
CACGGCCCTTCCAGCCTACCCTGGAGGAGATTGAAGAGTTTCTGGAGGAG
AACATGGAGCCTGGAGTCAAGGAGGTCCCTGAGGGCAACAGCAAGGACTT
GGATGCCTGCAGCCAGCTCTCAGCTGGGCCACACAAGAGCCACCTCCATC
CTGGGTCCAGCGGGAGAGAGCGCTGTTCCCCTCCACCAGGTGGTGCCAGT
GCAGGAGGTGCCCAGGGCCCAGGTGGGGGCCCCACGCCTGATGGCCCCAT
CCCAGTGTTGCTGCAGATCCAGCCCGTGCCTGTGAAGCAGGAATCGGGCA
CAGGGCCTGCCTCCCCTGGGCAAGCCCCAGAGAATGTCAAGGTTGCCCAG
CTCCTGGTCAACATCCAGGGGCAGACCTTCGCACTCGTGCCCCAGGTGGT
ACCCTCCTCCAACTTGAACCTGCCCTCCAAGTTTGTGCGCATTGCCCCTG
TGCCCATTGCCGCCAAGCCTGTTGGATCGGGACCCCTGGGGCCTGGCCCT
GCCGGTCTCCTCATGGGCCAGAAGTTCCCCAAGAACCCAGCCGCAGAACT
CATCAAAATGCACAAATGTACTTTCCCTGGCTGCAGCAAGATGTACACCA
AAAGCAGCCACCTCAAGGCCCACCTGCGCCGGCACACGGGTGAGAAGCCC
TTCGCCTGCACCTGGCCAGGCTGCGGCTGGAGGTTCTCGCGCTCTGACGA
GCTGTCGCGGCACAGGCGCTCGCACTCAGGTGTGAAGCCGTACCAGTGTC
CTGTGTGCGAGAAGAAGTTCGCGCGGAGCGACCACCTCTCCAAGCACATC
AAGGTGCACCGCTTCCCGCGGAGCAGCCGCTCCGTGCGCTCAGTGAACTG
CCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTAC
TTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACT
GCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGA
TGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGAT
CCTATCCATATGACGTTCCAGATTACGCTTGA
MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHMLPSPVSEDDSDASSPC
SCSSPDSQALCSCYGGGLGTESQDSILDFLLSQATLGSGGGSGSSIGASS
GPVAWGPWRRAAAPVKGEHFCLPEFPLGDPDDVPRPFQPTLEEIEEFLEE
NMEPGVKEVPEGNSKDLDACSQLSAGPHKSHLHPGSSGRERCSPPPGGAS
AGGAQGPGGGPTPDGPIPVLLQIQPVPVKQESGTGPASPGQAPENVKVAQ
LLVNIQGQTFALVPQVVPSSNLNLPSKFVRIAPVPIAAKPVGSGPLGPGP
AGLLMGQKFPKNPAAELIKMHKCTFPGCSKMYTKSSHLKAHLRRHTGEKP
FACTWPGCGWRFSRSDELSRHRRSHSGVKPYQCPVCEKKFARSDHLSKHI
KVHRFPRSSRSVRSVNCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGAT
AGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index