Stock Number Hs1527

Human Gene: CSNK1G2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CSNK1G2 casein kinase 1 gamma 2 HGNC:2455 19p13.3 gish 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03855 pGW-HA.attB ENST00000591752.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166211384915

Sequences

DNA sequence (1479 bp) Protein sequence (493 aa)
ATGGATTTTGACAAGAAAGGAGGGAAAGGGGAGACGGAGGAGGGCCGGAG
AATGTCCAAGGCCGGCGGGGGCCGGAGCAGCCACGGCATCCGGAGCTCGG
GGACCAGCTCGGGGGTCCTGATGGTGGGCCCCAACTTCCGCGTCGGCAAG
AAGATCGGCTGCGGCAACTTCGGGGAGCTCCGCCTAGGAAAGAATCTCTA
TACAAATGAATACGTGGCTATCAAATTGGAGCCGATCAAGTCCCGGGCCC
CGCAGCTGCACCTGGAGTACCGGTTCTACAAGCAGCTCAGCGCCACAGAG
GGCGTCCCTCAGGTCTACTACTTCGGTCCGTGCGGGAAGTACAACGCCAT
GGTGCTGGAGCTGCTGGGGCCCAGCCTGGAGGACCTGTTCGACCTGTGCG
ACCGGACCTTCACGCTCAAGACGGTGCTGATGATCGCCATCCAGCTGATC
ACGCGCATGGAGTATGTGCACACCAAGAGCCTAATCTACCGGGACGTGAA
GCCCGAGAACTTCCTGGTGGGCCGCCCGGGGACCAAGCGGCAGCATGCCA
TCCACATCATCGACTTCGGGCTGGCCAAGGAGTACATCGACCCCGAGACC
AAGAAGCACATCCCGTACCGCGAGCACAAGAGCCTGACGGGCACGGCGCG
CTACATGAGCATCAACACGCACCTGGGCAAGGAGCAGAGCCGCCGCGACG
ACCTGGAGGCGCTGGGCCACATGTTCATGTACTTCCTGCGCGGCAGCCTC
CCCTGGCAGGGGCTCAAGGCCGACACGCTCAAGGAGCGGTACCAGAAGAT
CGGGGACACCAAACGCGCCACGCCCATCGAGGTGCTCTGCGAGAACTTCC
CAGAGGAGATGGCCACGTACCTGCGCTATGTGCGGCGCCTGGACTTCTTC
GAGAAGCCCGACTATGACTACCTGCGGAAGCTCTTCACCGACCTCTTCGA
CCGCAGTGGCTTCGTGTTCGACTATGAGTACGACTGGGCCGGGAAGCCCC
TGCCGACCCCCATCGGCACCGTCCACACCGACCTGCCCTCCCAGCCTCAG
CTCCGGGACAAAACCCAGCCGCACAGCAAAAACCAGGCGTTGAACTCCAC
CAACGGGGAGCTGAATGCGGACGACCCCACGGCCGGCCACTCCAACGCCC
CGATCACAGCGCCTGCAGAGGTGGAGGTGGCCGATGAAACCAAATGCTGC
TGTTTCTTCAAGAGGAGAAAGAGAAAATCGCTGCAGCGACACAAGTGCCC
AACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTA
GTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCT
GGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGT
TCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCT
ATCCATATGACGTTCCAGATTACGCTTGA
MDFDKKGGKGETEEGRRMSKAGGGRSSHGIRSSGTSSGVLMVGPNFRVGK
KIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLSATE
GVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLI
TRMEYVHTKSLIYRDVKPENFLVGRPGTKRQHAIHIIDFGLAKEYIDPET
KKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSL
PWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFF
EKPDYDYLRKLFTDLFDRSGFVFDYEYDWAGKPLPTPIGTVHTDLPSQPQ
LRDKTQPHSKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCC
CFFKRRKRKSLQRHKCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATA
GAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index