Stock Number Hs1526

Human Gene: DOK2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
DOK2 docking protein 2 HGNC:2991 8p21.3 Dok X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03846 pGW-HA.attB ENST00000518197.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166211284914

Sequences

DNA sequence (1470 bp) Protein sequence (490 aa)
ATGGGAGACGGGGCAGTGAAACAAGGCTTCTTGTATCTTCAGCAGCAGCA
GACGTTTGGAAAGAAATGGCGCCGCTTCGGCGCCTCACTGTATGGAGGGT
CGGACTGCGCCTTGGCCCGGCTGGAGCTGCAGGAGGGCCCGGAGAAGCCT
CGTCGGTGTGAGGCTGCCCGGAAGGTCATCCGCCTCAGTGACTGCCTGCG
GGTGGCCGAGGCCGGCGGAGAGGCCAGCAGCCCCCGGGACACCAGTGCCT
TCTTCCTGGAGACCAAGGAGCGCCTGTACCTCCTGGCGGCCCCTGCAGCG
GAGCGCGGCGACTGGGTGCAGGCCATCTGCCTCCTGGCCTTCCCCGGGCA
GAGGAAGGAGCTCTCGGGGCCAGAGGGAAAGCAGAGCCGGCCCTGCATGG
AGGAAAATGAATTGTACAGCAGCGCAGTCACAGTCGGCCCCCACAAGGAA
TTTGCTGTGACCATGAGACCTACAGAAGCCAGTGAGAGGTGCCACCTGCG
GGGGTCCTATACCCTCCGGGCTGGGGAGAGTGCCCTGGAGCTGTGGGGTG
GGCCCGAGCCAGGGACCCAGCTGTACGACTGGCCCTACAGGTTTCTGCGG
CGCTTTGGGCGGGACAAGGTAACCTTTTCCTTTGAGGCAGGCCGTCGCTG
CGTCTCTGGAGAGGGCAACTTTGAGTTCGAAACCCGGCAAGGCAATGAGA
TCTTCTTGGCCCTGGAAGAGGCCATCTCTGCCCAGAAGAATGCTGCACCC
GCTACACCCCAACCGCAGCCAGCCACAATCCCCGCCTCGCTGCCCCGGCC
TGATAGCCCCTACTCTCGGCCGCATGACTCACTGCCGCCGCCTTCACCCA
CCACACCGGTGCCTGCTCCACGGCCTCGGGGCCAGGAGGGGGAGTATGCC
GTGCCCTTCGATGCGGTGGCCCGTTCCTTGGGGAAGAACTTCAGGGGCAT
CTTGGCAGTCCCTCCTCAGCTCCTGGCCGACCCTCTGTACGACAGCATTG
AGGAGACCCTGCCCCCTCGACCTGACCACATATACGATGAGCCCGAGGGA
GTGGCTGCCCTGTCCCTCTATGACAGCCCGCAGGAGCCCCGGGGTGAGGC
ATGGAGGAGGCAGGCGACAGCTGACAGGGACCCTGCTGGCCTCCAGCATG
TCCAGCCAGCTGGGCAGGATTTCTCTGCTTCTGGCTGGCAGCCAGGAACT
GAGTATGACAATGTTGTACTAAAGAAAGGCCCAAAGTGCCCAACTTTCTT
GTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAA
CTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGT
GGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTA
TGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATG
ACGTTCCAGATTACGCTTGA
MGDGAVKQGFLYLQQQQTFGKKWRRFGASLYGGSDCALARLELQEGPEKP
RRCEAARKVIRLSDCLRVAEAGGEASSPRDTSAFFLETKERLYLLAAPAA
ERGDWVQAICLLAFPGQRKELSGPEGKQSRPCMEENELYSSAVTVGPHKE
FAVTMRPTEASERCHLRGSYTLRAGESALELWGGPEPGTQLYDWPYRFLR
RFGRDKVTFSFEAGRRCVSGEGNFEFETRQGNEIFLALEEAISAQKNAAP
ATPQPQPATIPASLPRPDSPYSRPHDSLPPPSPTTPVPAPRPRGQEGEYA
VPFDAVARSLGKNFRGILAVPPQLLADPLYDSIEETLPPRPDHIYDEPEG
VAALSLYDSPQEPRGEAWRRQATADRDPAGLQHVQPAGQDFSASGWQPGT
EYDNVVLKKGPKCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAG
GAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index