Stock Number Hs1525

Human Gene: PELI3


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
PELI3 pellino E3 ubiquitin protein ligase family member 3 HGNC:30010 11q13.2 Pli 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02869 pGW-HA.attB ENST00000532970.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166211184913

Sequences

DNA sequence (1227 bp) Protein sequence (409 aa)
ATGGTGCTGGAAGGAAACCCTGAAGTGGGGTCCCCCCGAACCTCAGACCT
CCAGCACCGGGGGAACAAGGGCTCTTGCGTTCTCTCCTCTCCCGGTGAAG
ATGCGCAGCCAGGCGAGGAGCCCATCAAGTATGGTGAACTCATCGTCCTG
GGATGCTGTGAGGAAGGAGGTGAGGAAACCGAGGCTCAGAGAGGGGAAGT
GACTGGCCCAAGGGCACACAGCTGCTACAATGGTTGTCTGGCAAGTGGGG
ACAAGGGCCGCCGGCGAAGCCGCCTGGCACTGAGCCGCCGGTCGCACGCC
AACGGGGTGAAGCCAGACGTCATGCACCACATCTCCACGCCGCTCGTCTC
CAAGGCACTGAGTAACCGTGGTCAGCACAGCATCTCGTATACACTGTCCC
GGAGCCACTCGGTCATAGTGGAGTATACACATGATAGCGACACAGACATG
TTCCAGATTGGCCGCTCCACAGAGAACATGATTGACTTCGTGGTAACAGA
CACGTCCCCTGGAGGAGGGGCTGCCGAGGGCCCTTCTGCCCAGAGCACCA
TCTCCCGCTATGCCTGCCGCATCCTCTGTGACCGCCGGCCACCCTATACT
GCCCGCATCTATGCCGCTGGCTTCGACGCCTCTAGCAACATCTTCCTTGG
AGAGCGAGCGGCCAAATGGCGGACCCCAGATGGCCTGATGGATGGACTGA
CCACCAATGGAGTCCTGGTGATGCACCCGGCAGGCGGCTTCTCCGAGGAC
TCAGCCCCGGGTGTCTGGCGGGAGATCTCGGTCTGTGGGAATGTGTACAC
ATTGCGGGACAGCCGCTCAGCCCAGCAGCGGGGCAAGCTGGTAGGTGGCC
CGCTCCATTCCCCACCCCTATCCTTGCCAGGCCCTCACAAGCTGCCCATC
CCCCTGCCCAAGCCAGGAGATGATCTCCAGTCCTTCTGCCCCAGGGAGCC
CCAACAGGCTCCATATCAGGGAATCCCAGGCCCAGGGGGTTCTTACCCAA
CTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGT
ATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGG
CGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTC
CTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTAT
CCATATGACGTTCCAGATTACGCTTGA
MVLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVL
GCCEEGGEETEAQRGEVTGPRAHSCYNGCLASGDKGRRRSRLALSRRSHA
NGVKPDVMHHISTPLVSKALSNRGQHSISYTLSRSHSVIVEYTHDSDTDM
FQIGRSTENMIDFVVTDTSPGGGAAEGPSAQSTISRYACRILCDRRPPYT
ARIYAAGFDASSNIFLGERAAKWRTPDGLMDGLTTNGVLVMHPAGGFSED
SAPGVWREISVCGNVYTLRDSRSAQQRGKLVGGPLHSPPLSLPGPHKLPI
PLPKPGDDLQSFCPREPQQAPYQGIPGPGGSYPTFLYKVVVPRSSYSLLS
IGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSY
PYDVPDYA*

Index