Stock Number Hs1524

Human Gene: DOK3


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
DOK3 docking protein 3 HGNC:24583 5q35.3 Dok X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02861 pGW-HA.attB ENST00000506493.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166211084912

Sequences

DNA sequence (1224 bp) Protein sequence (408 aa)
ATGGACCCTCTGGAGACCCCTATCAAGGATGGCATCCTCTACCAGCAGCA
TGTCAAGTTTGGCAAGAAGTGCTGGCGGAAGGTGTGGGCTCTGCTGTATG
CAGGAGGCCCATCAGGCGTGGCACGGCTGGAGAGCTGGGAGGTCCGGGAT
GGTGGCCTGGGAGCAGCGGGTGACAGGTCGGCAGGGCCTGGCCGGCGAGG
GGAGCGACGGGTCATCCGCCTGGCTGACTGTGTGTCCGTGCTGCCGGCTG
ACGGCGAGAGCTGCCCCCGGGACACCGGTGCCTTCCTGCTCACCACCACC
GAGCGAAGCCATCTACTGGCTGCTCAGCACCGCCAGGCCTGGATGGGCCC
CATCTGCCAGCTGGCCTTCCCGGGGACAGGGGAGGCCTCCTCAGGATCCA
CAGATGCCCAGTCTCCCAAGAGGGGCCTGGTCCCCATGGAGGAAAACTCC
ATCTACTCCTCCTGGCAGGAAGTGGGCGAGTTTCCCGTGGTGGTGCAGAG
GACTGAGGCCGCCACCCGCTGCCAGCTGAAGGGGCCGGCCCTGCTGGTGC
TGGGCCCAGACGCCATCCAGCTGAGGGAGGCCAAGGGCACCCAGGCCCTC
TACAGCTGGCCCTACCACTTCCTGCGCAAGTTCGGCTCCGACAAGATACT
TCTGGGAACCCCAGGCGTCAGTCTCCTCATCTGTAAAGGAGAGAGAACCG
ATGACGTATCAGGCATAATCCTTGATGAGAGTTTGCTGCGTGCCTACTCA
GTGCCAGGCGCTGGGGGACACAGCCGTGTTCAGGACAGCCTTGGTCCTGT
TCTCCGGGAGCCGACATTCCAGGGGGAGAGAAGTTTCCTGAAGACTTCCA
TGCTGCGTTCCCTCCTCTGCTCCTGCTCCTGGCGCCATCCTAGGAGCCAG
CCATGCACGCAAGCGTCATGCCTCCAGGGCTCTGACTGCCCAGCCCCTCA
CCGCAACTCCACCTCAGCTGCACACACCCTTGGCACATCCTGCCCAACTT
TCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATA
GGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGC
TGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTG
ACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCA
TATGACGTTCCAGATTACGCTTGA
MDPLETPIKDGILYQQHVKFGKKCWRKVWALLYAGGPSGVARLESWEVRD
GGLGAAGDRSAGPGRRGERRVIRLADCVSVLPADGESCPRDTGAFLLTTT
ERSHLLAAQHRQAWMGPICQLAFPGTGEASSGSTDAQSPKRGLVPMEENS
IYSSWQEVGEFPVVVQRTEAATRCQLKGPALLVLGPDAIQLREAKGTQAL
YSWPYHFLRKFGSDKILLGTPGVSLLICKGERTDDVSGIILDESLLRAYS
VPGAGGHSRVQDSLGPVLREPTFQGERSFLKTSMLRSLLCSCSWRHPRSQ
PCTQASCLQGSDCPAPHRNSTSAAHTLGTSCPTFLYKVVVPRSSYSLLSI
GTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYP
YDVPDYA*

Index