Stock Number Hs1523

Human Gene: PLSCR4


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
PLSCR4 phospholipid scramblase 4 HGNC:16497 3q24 scramb1 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02852 pGW-HA.attB ENST00000493382.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166210984911

Sequences

DNA sequence (1221 bp) Protein sequence (407 aa)
ATGTCAGGTGTGGTACCCACAGCCCCTGAACAGCCTGCAGGTGAAATGGA
AAATCAAACAAAACCACCAGATCCAAGGCCTGATGCTCCTCCTGAATACA
ATTCTCATTTTTTACCAGGACCCCCTGGAACAGCTGTCCCTCCACCTACT
GGCTACCCAGGAGGCTTGCCTATGGGATACTACAGTCCACAGCAACCCAG
TACCTTCCCTTTGTACCAGCCAGTTGGTGGTATCCATCCTGTCCGGTATC
AGCCTGGCAAATATCCTATGCCAAATCAGTCTGTTCCAATAACATGGATG
CCAGGGCCAACTCCTATGGCAAACTGCCCTCCTGGTCTGGAATACTTAGT
TCAGTTGGACAACATACATGTTCTTCAGCATTTTGAGCCTCTGGAAATGA
TGACATGTTTTGAAACTAATAATAGATATGATATTAAAAACAACTCAGAC
CAGATGGTTTACATTGTAACCGAAGACACAGATGACTTTACCAGGAATGC
CTATCGGACACTAAGGCCCTTCGTCCTCCGGGTCACTGATTGTATGGGCC
GAGAAATCATGACAATGCAGAGACCCTTCAGATGCACCTGCTGTTGCTTC
TGTTGCCCCTCTGCCAGACAAGAGCTGGAGGTGCAGTGTCCTCCTGGTGT
CACCATTGGCTTTGTTGCGGAACATTGGAACCTGTGCAGGGCGGTGTACA
GCATCCAAAATGAGAAGAAAGAAAATGTGATGAGAGTTCGTGGGCCATGC
TCAACCTATGGCTGTGGTTCAGATTCTGTTTTTGAGGTCAAATCCCTTGA
TGGCATATCCAACATCGGCAGTATTATCCGGAAGTGGAATGGTTTGTTAT
CAGCAATGGCAGATGCTGACCATTTTGACATTCACTTCCCACTAGACCTG
GATGTGAAGATGAAAGCCATGATTTTTGGAGCTTGCTTCCTCATTGACTT
CATGTATTTTGAAAGATCTCCACCACAACGTTCAAGATACCCAACTTTCT
TGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGA
ACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGG
TGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACT
ATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATAT
GACGTTCCAGATTACGCTTGA
MSGVVPTAPEQPAGEMENQTKPPDPRPDAPPEYNSHFLPGPPGTAVPPPT
GYPGGLPMGYYSPQQPSTFPLYQPVGGIHPVRYQPGKYPMPNQSVPITWM
PGPTPMANCPPGLEYLVQLDNIHVLQHFEPLEMMTCFETNNRYDIKNNSD
QMVYIVTEDTDDFTRNAYRTLRPFVLRVTDCMGREIMTMQRPFRCTCCCF
CCPSARQELEVQCPPGVTIGFVAEHWNLCRAVYSIQNEKKENVMRVRGPC
STYGCGSDSVFEVKSLDGISNIGSIIRKWNGLLSAMADADHFDIHFPLDL
DVKMKAMIFGACFLIDFMYFERSPPQRSRYPTFLYKVVVPRSSYSLLSIG
TSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPY
DVPDYA*

Index