Stock Number Hs1522

Human Gene: RCN3


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
RCN3 reticulocalbin 3 HGNC:21145 19q13.33 scf 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02851 pGW-HA.attB ENST00000270645.7 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166210884910

Sequences

DNA sequence (1218 bp) Protein sequence (406 aa)
ATGATGTGGCGACCATCAGTTCTGCTGCTTCTGTTGCTACTGAGGCACGG
GGCCCAGGGGAAGCCATCCCCAGACGCAGGCCCTCATGGCCAGGGGAGGG
TGCACCAGGCGGCCCCCCTGAGCGACGCTCCCCATGATGACGCCCACGGG
AACTTCCAGTACGACCATGAGGCTTTCCTGGGACGGGAAGTGGCCAAGGA
ATTCGACCAACTCACCCCAGAGGAAAGCCAGGCCCGTCTGGGGCGGATCG
TGGACCGCATGGACCGCGCGGGGGACGGCGACGGCTGGGTGTCGCTGGCC
GAGCTTCGCGCGTGGATCGCGCACACGCAGCAGCGGCACATACGGGACTC
GGTGAGCGCGGCCTGGGACACGTACGACACGGACCGCGACGGGCGTGTGG
GTTGGGAGGAGCTGCGCAACGCCACCTATGGCCACTACGCGCCCGGTGAA
GAATTTCATGACGTGGAGGATGCAGAGACCTACAAAAAGATGCTGGCTCG
GGACGAGCGGCGTTTCCGGGTGGCCGACCAGGATGGGGACTCGATGGCCA
CTCGAGAGGAGCTGACAGCCTTCCTGCACCCCGAGGAGTTCCCTCACATG
CGGGACATCGTGATTGCTGAAACCCTGGAGGACCTGGACAGAAACAAAGA
TGGCTATGTCCAGGTGGAGGAGTACATCGCGGATCTGTACTCAGCCGAGC
CTGGGGAGGAGGAGCCGGCGTGGGTGCAGACGGAGAGGCAGCAGTTCCGG
GACTTCCGGGATCTGAACAAGGATGGGCACCTGGATGGGAGTGAGGTGGG
CCACTGGGTGCTGCCCCCTGCCCAGGACCAGCCCCTGGTGGAAGCCAACC
ACCTGCTGCACGAGAGCGACACGGACAAGGATGGGCGGCTGAGCAAAGCG
GAAATCCTGGGTAATTGGAACATGTTTGTGGGCAGTCAGGCCACCAACTA
TGGCGAGGACCTGACCCGGCACCACGATGAGCTGTGCCCAACTTTCTTGT
ACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACT
TCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGG
AGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATG
CGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGAC
GTTCCAGATTACGCTTGA
MMWRPSVLLLLLLLRHGAQGKPSPDAGPHGQGRVHQAAPLSDAPHDDAHG
NFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLA
ELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGE
EFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHM
RDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFR
DFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKA
EILGNWNMFVGSQATNYGEDLTRHHDELCPTFLYKVVVPRSSYSLLSIGT
SILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYD
VPDYA*

Index