Stock Number Hs1521

Human Gene: HMGCL


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
HMGCL 3-hydroxy-3-methylglutaryl-CoA lyase HGNC:5005 1p36.11 Hmgcl 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02829 pGW-HA.attB ENST00000374490.7 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166210784909

Sequences

DNA sequence (1209 bp) Protein sequence (403 aa)
ATGGCAGCAATGAGGAAGGCGCTTCCGCGGCGACTGGTGGGCTTGGCGTC
CCTCCGGGCTGTCAGCACCTCATCTATGGGCACTTTACCAAAGCGGGTGA
AAATTGTGGAAGTTGGTCCCCGAGATGGACTACAAAATGAAAAGAATATC
GTATCTACTCCAGTGAAAATCAAGCTGATAGACATGCTTTCTGAAGCAGG
ACTCTCTGTTATAGAAACCACCAGCTTTGTGTCTCCTAAGTGGGTTCCCC
AGATGGGTGACCACACTGAAGTCTTGAAGGGCATTCAGAAGTTTCCTGGC
ATCAACTACCCAGTCCTGACCCCAAATTTGAAAGGCTTCGAGGCAGCGGT
TGCTGCTGGAGCCAAGGAAGTAGTCATCTTTGGAGCTGCCTCAGAGCTCT
TCACCAAGAAGAACATCAATTGTTCCATAGAGGAGAGTTTTCAGAGGTTT
GACGCAATCCTGAAGGCAGCGCAGTCAGCCAATATTTCTGTGCGGGGGTA
CGTCTCCTGTGCTCTTGGCTGCCCTTATGAAGGGAAGATCTCCCCAGCTA
AAGTAGCTGAGGTCACCAAGAAGTTCTACTCAATGGGCTGCTACGAGATC
TCCCTGGGGGACACCATTGGTGTGGGCACCCCAGGGATCATGAAAGACAT
GCTGTCTGCTGTCATGCAGGAAGTGCCTCTGGCTGCCCTGGCTGTCCACT
GCCATGACACCTATGGTCAAGCCCTGGCCAACACCTTGATGGCCCTGCAG
ATGGGAGTGAGTGTCGTGGACTCTTCTGTGGCAGGACTTGGAGGCTGTCC
CTACGCACAGGGGGCATCAGGAAACTTGGCCACAGAAGACCTGGTCTACA
TGCTAGAGGGCTTGGGCATTCACACGGGTGTGAATCTCCAGAAGCTTCTG
GAAGCTGGAAACTTTATCTGTCAAGCCCTGAACAGAAAAACTAGCTCCAA
AGTGGCTCAGGCTACCTGTAAACTCTGCCCAACTTTCTTGTACAAAGTGG
TGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTT
GGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGG
ACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATC
CCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGAT
TACGCTTGA
MAAMRKALPRRLVGLASLRAVSTSSMGTLPKRVKIVEVGPRDGLQNEKNI
VSTPVKIKLIDMLSEAGLSVIETTSFVSPKWVPQMGDHTEVLKGIQKFPG
INYPVLTPNLKGFEAAVAAGAKEVVIFGAASELFTKKNINCSIEESFQRF
DAILKAAQSANISVRGYVSCALGCPYEGKISPAKVAEVTKKFYSMGCYEI
SLGDTIGVGTPGIMKDMLSAVMQEVPLAALAVHCHDTYGQALANTLMALQ
MGVSVVDSSVAGLGGCPYAQGASGNLATEDLVYMLEGLGIHTGVNLQKLL
EAGNFICQALNRKTSSKVAQATCKLCPTFLYKVVVPRSSYSLLSIGTSIL
GAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPD
YA*

Index