Stock Number Hs1520

Human Gene: CDK6


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CDK6 cyclin dependent kinase 6 HGNC:1777 7q21.2 Cdk4 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02841 pGW-HA.attB ENST00000424848.2 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166210684908

Sequences

DNA sequence (1212 bp) Protein sequence (404 aa)
ATGGAGAAGGACGGCCTGTGCCGCGCTGACCAGCAGTACGAATGCGTGGC
GGAGATCGGGGAGGGCGCCTATGGGAAGGTGTTCAAGGCCCGCGACTTGA
AGAACGGAGGCCGTTTCGTGGCGTTGAAGCGCGTGCGGGTGCAGACCGGC
GAGGAGGGCATGCCGCTCTCCACCATCCGCGAGGTGGCGGTGCTGAGGCA
CCTGGAGACCTTCGAGCACCCCAACGTGGTCAGGTTGTTTGATGTGTGCA
CAGTGTCACGAACAGACAGAGAAACCAAACTAACTTTAGTGTTTGAACAT
GTCGATCAAGACTTGACCACTTACTTGGATAAAGTTCCAGAGCCTGGAGT
GCCCACTGAAACCATAAAGGATATGATGTTTCAGCTTCTCCGAGGTCTGG
ACTTTCTTCATTCACACCGAGTAGTGCATCGCGATCTAAAACCACAGAAC
ATTCTGGTGACCAGCAGCGGACAAATAAAACTCGCTGACTTCGGCCTTGC
CCGCATCTATAGTTTCCAGATGGCTCTAACCTCAGTGGTCGTCACGCTGT
GGTACAGAGCACCCGAAGTCTTGCTCCAGTCCAGCTACGCCACCCCCGTG
GATCTCTGGAGTGTTGGCTGCATATTTGCAGAAATGTTTCGTAGAAAGCC
TCTTTTTCGTGGAAGTTCAGATGTTGATCAACTAGGAAAAATCTTGGACG
TGATTGGACTCCCAGGAGAAGAAGACTGGCCTAGAGATGTTGCCCTTCCC
AGGCAGGCTTTTCATTCAAAATCTGCCCAACCAATTGAGAAGTTTGTAAC
AGATATCGATGAACTAGGCAAAGACCTACTTCTGAAGTGTTTGACATTTA
ACCCAGCCAAAAGAATATCTGCCTACAGTGCCCTGTCTCACCCATACTTC
CAGGACCTGGAAAGGTGCAAAGAAAACCTGGATTCCCACCTGCCGCCCAG
CCAGAACACCTCGGAGCTGAATACAGCCTGCCCAACTTTCTTGTACAAAG
TGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATC
CTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGG
TGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCT
ATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCA
GATTACGCTTGA
MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTG
EEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEH
VDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQN
ILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPV
DLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALP
RQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF
QDLERCKENLDSHLPPSQNTSELNTACPTFLYKVVVPRSSYSLLSIGTSI
LGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVP
DYA*

Index