Stock Number Hs1519

Human Gene: TRAM2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
TRAM2 translocation associated membrane protein 2 HGNC:16855 6p12.2 TRAM X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03244 pGW-HA.attB ENST00000182527.3 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166210584907

Sequences

DNA sequence (1344 bp) Protein sequence (448 aa)
ATGGCTTTCCGCAGGAGGACGAAAAGTTACCCGCTCTTCAGCCAGGAGTT
CGTCATCCACAACCATGCGGACATCGGCTTCTGCCTGGTGCTCTGCGTCC
TCATCGGGCTTATGTTCGAGGTCACAGCCAAGACTGCCTTTCTATTTATT
TTACCTCAGTATAACATTAGCGTGCCTACAGCAGACAGTGAGACCGTGCA
CTACCACTATGGCCCTAAGGACCTGGTCACAATCTTGTTCTACATCTTCA
TCACCATCATCTTGCATGCTGTGGTTCAGGAGTACATTTTAGATAAAATC
AGCAAACGGCTTCATCTCTCCAAAGTCAAACACAGCAAGTTCAATGAATC
TGGACAGCTGGTCGTCTTTCATTTCACCTCGGTGATTTGGTGCTTCTACG
TGGTGGTGACGGAAGGATACTTAACAAACCCAAGAAGCCTCTGGGAAGAC
TACCCGCATGTGCACCTCCCCTTCCAGGTGAAGTTTTTCTACCTATGCCA
GCTGGCCTACTGGCTGCACGCACTTCCTGAGCTATACTTCCAGAAGGTAC
GGAAGGAGGAAATTCCCCGCCAGCTCCAGTATATTTGCCTGTACCTGGTG
CATATAGCTGGAGCATACCTCTTAAACCTGAGCCGCCTGGGCCTGATCTT
GCTGCTGCTGCAGTACTCAACTGAGTTCCTCTTCCACACGGCTAGACTCT
TCTACTTTGCAGATGAAAACAACGAGAAACTGTTCAGTGCCTGGGCTGCT
GTTTTTGGGGTTACCCGCCTCTTCATCCTCACCCTTGCCGTGCTGGCCAT
TGGCTTTGGACTGGCTCGCATGGAAAACCAGGCATTTGATCCCGAGAAAG
GGAACTTCAACACTTTGTTTTGCAGGCTCTGCGTGCTGCTGCTGGTGTGT
GCCGCCCAGGCCTGGCTCATGTGGCGCTTCATCCACTCCCAGCTGCGGCA
CTGGCGGGAATACTGGAATGAGCAGAGTGCAAAGCGGAGAGTCCCAGCCA
CACCCAGACTACCAGCCAGGCTCATCAAGAGGGAATCTGGTTACCATGAA
AATGGAGTGGTGAAGGCAGAGAACGGAACCTCCCCACGGACTAAGAAACT
CAAGTCTCCCTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTT
CCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGA
GGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAAT
TTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGG
ACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MAFRRRTKSYPLFSQEFVIHNHADIGFCLVLCVLIGLMFEVTAKTAFLFI
LPQYNISVPTADSETVHYHYGPKDLVTILFYIFITIILHAVVQEYILDKI
SKRLHLSKVKHSKFNESGQLVVFHFTSVIWCFYVVVTEGYLTNPRSLWED
YPHVHLPFQVKFFYLCQLAYWLHALPELYFQKVRKEEIPRQLQYICLYLV
HIAGAYLLNLSRLGLILLLLQYSTEFLFHTARLFYFADENNEKLFSAWAA
VFGVTRLFILTLAVLAIGFGLARMENQAFDPEKGNFNTLFCRLCVLLLVC
AAQAWLMWRFIHSQLRHWREYWNEQSAKRRVPATPRLPARLIKRESGYHE
NGVVKAENGTSPRTKKLKSPYPTFLYKVVVPRSSYSLLSIGTSILGAPSG
GGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index