Stock Number Hs1518

Human Gene: WNT9A


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
WNT9A Wnt family member 9A HGNC:12778 1q42.13 Wnt4 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03222 pGW-HA.attB ENST00000272164.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166210484906

Sequences

DNA sequence (1329 bp) Protein sequence (443 aa)
ATGCTGGATGGGTCCCCGCTGGCGCGCTGGCTGGCCGCGGCCTTCGGGCT
GACGCTGCTGCTCGCCGCGCTGCGCCCTTCGGCCGCCTACTTCGGGCTGA
CGGGCAGCGAGCCCCTGACCATCCTCCCGCTGACCCTGGAGCCAGAGGCG
GCCGCCCAGGCGCACTACAAGGCCTGCGACCGGCTGAAGCTGGAGCGGAA
GCAGCGGCGCATGTGCCGCCGGGACCCGGGCGTGGCAGAGACGCTGGTGG
AGGCCGTGAGCATGAGTGCGCTCGAGTGCCAGTTCCAGTTCCGCTTTGAG
CGCTGGAACTGCACGCTGGAGGGCCGCTACCGGGCCAGCCTGCTCAAGCG
AGGCTTCAAGGAGACTGCCTTCCTCTATGCCATCTCCTCGGCTGGCCTGA
CGCACGCACTGGCCAAGGCGTGCAGCGCGGGCCGCATGGAGCGCTGTACC
TGCGATGAGGCACCCGACCTGGAGAACCGTGAGGCCTGGCAGTGGGGGGG
CTGCGGAGACAACCTTAAGTACAGCAGCAAGTTCGTCAAGGAATTCCTGG
GCAGACGGTCAAGCAAGGATCTGCGAGCCCGTGTGGACTTCCACAACAAC
CTCGTGGGTGTGAAGGTGATCAAGGCTGGGGTGGAGACCACCTGCAAGTG
CCACGGCGTGTCAGGCTCATGCACGGTGCGGACCTGCTGGCGGCAGTTGG
CGCCTTTCCATGAGGTGGGCAAGCATCTGAAGCACAAGTATGAGACGGCA
CTCAAGGTGGGCAGCACCACCAATGAAGCTGCCGGCGAGGCAGGTGCCAT
CTCCCCACCACGGGGCCGTGCCTCGGGGGCAGGTGGCAGCGACCCGCTGC
CCCGCACTCCAGAGCTGGTGCACCTGGATGACTCGCCTAGCTTCTGCCTG
GCTGGCCGCTTCTCCCCGGGCACCGCTGGCCGTAGGTGCCACCGTGAGAA
GAACTGCGAGAGCATCTGCTGTGGCCGCGGCCATAACACACAGAGCCGGG
TGGTGACAAGGCCCTGCCAGTGCCAGGTGCGTTGGTGCTGCTATGTGGAG
TGCAGGCAGTGCACGCAGCGTGAGGAGGTCTACACCTGCAAGGGCTTGCC
AACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTA
GTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCT
GGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGT
TCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCT
ATCCATATGACGTTCCAGATTACGCTTGA
MLDGSPLARWLAAAFGLTLLLAALRPSAAYFGLTGSEPLTILPLTLEPEA
AAQAHYKACDRLKLERKQRRMCRRDPGVAETLVEAVSMSALECQFQFRFE
RWNCTLEGRYRASLLKRGFKETAFLYAISSAGLTHALAKACSAGRMERCT
CDEAPDLENREAWQWGGCGDNLKYSSKFVKEFLGRRSSKDLRARVDFHNN
LVGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVGKHLKHKYETA
LKVGSTTNEAAGEAGAISPPRGRASGAGGSDPLPRTPELVHLDDSPSFCL
AGRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVE
CRQCTQREEVYTCKGLPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATA
GAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index