Stock Number Hs1517

Human Gene: PCYT1A


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
PCYT1A phosphate cytidylyltransferase 1, choline, alpha HGNC:8754 3q29 Pcyt1 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03229 pGW-HA.attB ENST00000431016.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166210384905

Sequences

DNA sequence (1335 bp) Protein sequence (445 aa)
ATGGATGCACAGTGTTCAGCCAAGGTCAATGCAAGGAAGAGGAGAAAAGA
GGCGCCCGGACCCAACGGGGCAACAGAAGAAGATGGGGTTCCTTCCAAAG
TGCAGCGCTGTGCAGTGGGCTTACGGCAACCAGCTCCTTTTTCTGATGAA
ATTGAAGTTGACTTTAGTAAGCCCTATGTCAGGGTAACTATGGAAGAAGC
CAGCAGAGGAACTCCTTGTGAGCGACCTGTGAGAGTTTATGCCGATGGAA
TATTTGACTTATTTCACTCTGGTCACGCCCGAGCTCTGATGCAAGCGAAG
AACCTTTTCCCTAATACGTACCTCATTGTGGGAGTTTGCAGTGATGAGCT
CACACACAACTTCAAAGGCTTCACGGTGATGAACGAGAATGAGCGCTATG
ACGCAGTCCAGCACTGCCGCTACGTGGATGAGGTGGTGAGGAATGCGCCC
TGGACGCTGACACCCGAGTTCCTGGCCGAACACCGGATTGATTTTGTAGC
CCATGATGATATTCCTTATTCATCTGCTGGCAGTGATGATGTTTATAAGC
ACATCAAGGAGGCAGGCATGTTTGCTCCAACACAGAGGACAGAAGGTATC
TCCACATCAGACATCATCACCCGAATTGTGCGGGATTATGATGTGTATGC
GAGGCGGAACCTGCAGAGGGGCTACACAGCAAAGGAGCTCAATGTCAGCT
TTATCAACGAGAAGAAATACCACTTGCAGGAGAGGGTTGACAAAGTAAAG
AAGAAAGTGAAAGATGTGGAGGAAAAGTCAAAAGAATTTGTTCAGAAGGT
GGAGGAAAAAAGCATTGACCTCATTCAGAAGTGGGAGGAGAAGTCCCGAG
AATTCATTGGAAGTTTTCTGGAAATGTTTGGTCCGGAAGGAGCACTGAAA
CATATGCTGAAAGAGGGGAAGGGCCGGATGCTGCAGGCCATCAGCCCGAA
GCAGAGCCCCAGCAGCAGCCCTACTCGCGAGCGCTCCCCCTCCCCCTCTT
TCCGATGGCCCTTCTCCGGCAAGACTTCCCCACCTTGCTCCCCAGCAAAT
CTCTCCAGGCACAAGGCTGCAGCCTATGATATCAGTGAGGATGAAGAAGA
CTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTC
TACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCT
ACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATA
CGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAG
GATCCTATCCATATGACGTTCCAGATTACGCTTGA
MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDE
IEVDFSKPYVRVTMEEASRGTPCERPVRVYADGIFDLFHSGHARALMQAK
NLFPNTYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCRYVDEVVRNAP
WTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGI
STSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKKYHLQERVDKVK
KKVKDVEEKSKEFVQKVEEKSIDLIQKWEEKSREFIGSFLEMFGPEGALK
HMLKEGKGRMLQAISPKQSPSSSPTRERSPSPSFRWPFSGKTSPPCSPAN
LSRHKAAAYDISEDEEDYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGA
TAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index