Stock Number Hs1516

Human Gene: TSSK1B


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
TSSK1B testis specific serine kinase 1B HGNC:14968 5q22.2 CG14305 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03227 pGW-HA.attB ENST00000390666.3 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166210284904

Sequences

DNA sequence (1335 bp) Protein sequence (445 aa)
ATGGATGACGCTGCTGTCCTCAAGCGACGAGGCTACCTCCTGGGGATAAA
TTTAGGAGAGGGCTCCTATGCAAAAGTAAAATCTGCTTACTCTGAGCGCC
TGAAGTTCAATGTGGCGATCAAGATCATCGACCGCAAGAAGGCCCCCGCA
GACTTCTTGGAGAAATTCCTTCCCCGGGAAATTGAGATTCTGGCCATGTT
AAACCACTGCTCCATCATTAAGACCTACGAGATCTTTGAGACATCACATG
GCAAGGTCTACATCGTCATGGAGCTCGCGGTCCAGGGCGACCTCCTCGAG
TTAATCAAAACCCGGGGAGCCCTGCATGAGGACGAAGCTCGCAAGAAGTT
CCACCAGCTTTCCTTGGCCATCAAGTACTGCCACGACCTGGACGTCGTCC
ACCGGGACCTCAAGTGTGACAACCTTCTCCTTGACAAGGACTTCAACATC
AAGCTGTCCGACTTCAGCTTCTCCAAGCGCTGCCTGCGGGATGACAGTGG
TCGAATGGCATTAAGCAAGACCTTCTGTGGGTCACCAGCGTATGCGGCCC
CAGAGGTGCTGCAGGGCATTCCCTACCAGCCCAAGGTGTACGACATCTGG
AGCCTAGGCGTGATCCTCTACATCATGGTCTGCGGCTCCATGCCCTACGA
CGACTCCAACATCAAGAAGATGCTGCGTATCCAGAAGGAGCACCGCGTCA
ACTTCCCACGCTCCAAGCACCTGACAGGCGAGTGCAAGGACCTCATCTAC
CACATGCTGCAGCCCGACGTCAACCGGCGGCTCCACATCGACGAGATCCT
CAGCCACTGCTGGATGCAGCCCAAGGCACGGGGATCTCCCTCTGTGGCCA
TCAACAAGGAGGGGGAGAGTTCCCGGGGAACTGAACCCTTGTGGACCCCC
GAACCTGGCTCTGACAAGAAGTCTGCCACCAAGCTGGAGCCTGAGGGAGA
GGCACAGCCCCAGGCACAGCCTGAGACAAAACCCGAGGGGACAGCAATGC
AAATGTCCAGGCAGTCGGAGATCCTGGGTTTCCCCAGCAAGCCGTCGACT
ATGGAGACAGAGGAAGGGCCCCCCCAACAGCCTCCAGAGACGCGGGCACA
GTGCCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTC
TACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCT
ACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATA
CGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAG
GATCCTATCCATATGACGTTCCAGATTACGCTTGA
MDDAAVLKRRGYLLGINLGEGSYAKVKSAYSERLKFNVAIKIIDRKKAPA
DFLEKFLPREIEILAMLNHCSIIKTYEIFETSHGKVYIVMELAVQGDLLE
LIKTRGALHEDEARKKFHQLSLAIKYCHDLDVVHRDLKCDNLLLDKDFNI
KLSDFSFSKRCLRDDSGRMALSKTFCGSPAYAAPEVLQGIPYQPKVYDIW
SLGVILYIMVCGSMPYDDSNIKKMLRIQKEHRVNFPRSKHLTGECKDLIY
HMLQPDVNRRLHIDEILSHCWMQPKARGSPSVAINKEGESSRGTEPLWTP
EPGSDKKSATKLEPEGEAQPQAQPETKPEGTAMQMSRQSEILGFPSKPST
METEEGPPQQPPETRAQCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGA
TAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index