Stock Number Hs1515

Human Gene: LMCD1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
LMCD1 LIM and cysteine rich domains 1 HGNC:6633 3p25.3 Tes 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03226 pGW-HA.attB ENST00000157600.7 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166210184903

Sequences

DNA sequence (1329 bp) Protein sequence (443 aa)
ATGGCAAAGGTGGCTAAGGACCTCAACCCAGGAGTTAAAAAGATGTCCCT
GGGCCAGCTGCAGTCAGCAAGAGGTGTGGCATGTTTGGGATGCAAGGGGA
CGTGTTCGGGCTTCGAGCCACATTCATGGAGGAAAATATGCAAGTCTTGC
AAATGCAGCCAAGAGGACCACTGCCTAACATCTGACCTAGAAGACGATCG
GAAAATTGGCCGCTTGCTGATGGACTCCAAGTATTCCACCCTCACTGCTC
GGGTGAAAGGCGGGGACGGCATCCGGATTTACAAGAGGAACCGGATGATC
ATGACCAACCCTATTGCTACTGGGAAAGATCCCACTTTTGACACCATCAC
CTACGAGTGGGCTCCCCCTGGAGTCACCCAGAAACTGGGACTGCAGTACA
TGGAGCTCATCCCCAAGGAGAAGCAGCCAGTGACAGGCACAGAGGGTGCC
TTTTACCGCCGCCGCCAGCTCATGCACCAGCTCCCCATCTATGACCAGGA
TCCCTCGCGCTGCCGTGGACTTTTGGAGAATGAGTTGAAACTGATGGAAG
AATTTGTCAAGCAATATAAGAGCGAGGCCCTCGGCGTGGGAGAAGTGGCC
CTCCCGGGGCAGGGTGGCTTGCCCAAGGAGGAGGGGAAGCAGCAGGAAAA
GCCAGAGGGGGCAGAGACCACTGCTGCTACCACCAACGGCAGTCTCAGTG
ACCCGTCCAAAGAAGTGGAATACGTCTGCGAGCTCTGCAAGGGAGCGGCC
CCTCCTGACAGCCCCGTGGTCTACTCGGACAGGGCAGGCTACAACAAGCA
GTGGCACCCCACCTGCTTTGTGTGTGCCAAGTGCTCCGAGCCGCTGGTGG
ACCTCATCTACTTCTGGAAGGATGGTGCACCCTGGTGCGGCCGCCATTAC
TGCGAGAGTCTGCGGCCCCGGTGCTCCGGCTGCGATGAGATAATATTCGC
TGAGGACTACCAGCGTGTGGAAGATCTGGCCTGGCACCGAAAGCACTTTG
TCTGTGAGGGTTGTGAGCAGCTGCTGAGCGGCCGGGCGTACATCGTCACC
AAGGGTCAGCTTCTGTGCCCAACTTGCAGCAAGTCCAAACGCTCCTGCCC
AACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTA
GTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCT
GGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGT
TCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCT
ATCCATATGACGTTCCAGATTACGCTTGA
MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSC
KCSQEDHCLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMI
MTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGA
FYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVA
LPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAA
PPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHY
CESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVT
KGQLLCPTCSKSKRSCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATA
GAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index