Stock Number Hs1513

Human Gene: NIPA2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
NIPA2 NIPA magnesium transporter 2 HGNC:17044 15q11.2 spict 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03206 pGW-HA.attB ENST00000560039.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166209984902

Sequences

DNA sequence (1314 bp) Protein sequence (438 aa)
ATGAGTCAGGGGCGTGGAAAATATGACTTCTATATTGGTCTGGGATTGGC
TATGAGCTCCAGCATTTTCATTGGAGGAAGTTTCATTTTGAAAAAAAAGG
GCCTCCTTCGACTTGCCAGGAAAGGCTCTATGAGAGCAGGTCAAGGTGGC
CATGCATATCTTAAGGAATGGTTGTGGTGGGCTGGACTGCTGTCAATGGG
AGCTGGTGAGGTGGCCAACTTCGCTGCGTATGCGTTTGCACCAGCCACTC
TAGTGACTCCACTAGGAGCTCTCAGCGTGCTAGTAAGTGCCATTCTTTCT
TCATACTTTCTCAATGAAAGACTTAATCTTCATGGGAAAATTGGGTGTTT
GCTAAGTATTCTAGGATCTACAGTTATGGTCATTCATGCTCCAAAGGAAG
AGGAGATTGAGACTTTAAATGAAATGTCTCACAAGCTAGGTGATCCAGGT
TTTGTGGTCTTTGCAACCCTTGTGGTCATTGTGGCCTTGATATTAATCTT
CGTGGTGGGTCCTCGCCATGGACAGACAAACATTCTTGTGTACATAACAA
TCTGCTCTGTAATCGGCGCGTTTTCAGTCTCCTGTGTGAAGGGCCTGGGC
ATTGCTATCAAGGAGCTGTTTGCAGGGAAGCCTGTGCTGCGGCATCCCCT
GGCTTGGATTCTGCTGCTGAGCCTCATCGTCTGTGTGAGCACACAGATTA
ATTACCTAAATAGGGCCCTGGATATATTCAACACTTCCATTGTGACTCCA
ATATATTATGTATTCTTTACAACATCAGTTTTAACTTGTTCAGCTATTCT
TTTTAAGGAGTGGCAAGATATGCCTGTTGACGATGTCATTGGTACTTTGA
GTGGCTTCTTTACAATCATTGTGGGGATATTCTTGTTGCATGCCTTTAAA
GACGTCGGCTTTAGTCTAGCAAGTCTGCCTGTGTCTTTTCGAAAAGACGA
GAAAGCAATGAATGGCAATCTCTCTAATATGTATGAAGTTCTTAATAATA
ATGAAGAAAGCTTAACCTGTGGAATCGAACAACACACTGGTGAAAATGTC
TCCCGAAGAAATGGAAATCTGACAGCTTTTTACCCAATTTTCTTGTACAA
AGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCA
TCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCC
GGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGG
CTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTC
CAGATTACGCTTGA
MSQGRGKYDFYIGLGLAMSSSIFIGGSFILKKKGLLRLARKGSMRAGQGG
HAYLKEWLWWAGLLSMGAGEVANFAAYAFAPATLVTPLGALSVLVSAILS
SYFLNERLNLHGKIGCLLSILGSTVMVIHAPKEEEIETLNEMSHKLGDPG
FVVFATLVVIVALILIFVVGPRHGQTNILVYITICSVIGAFSVSCVKGLG
IAIKELFAGKPVLRHPLAWILLLSLIVCVSTQINYLNRALDIFNTSIVTP
IYYVFFTTSVLTCSAILFKEWQDMPVDDVIGTLSGFFTIIVGIFLLHAFK
DVGFSLASLPVSFRKDEKAMNGNLSNMYEVLNNNEESLTCGIEQHTGENV
SRRNGNLTAFYPIFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGA
GGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index