Stock Number Hs1512

Human Gene: DNASE2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
DNASE2 deoxyribonuclease 2, lysosomal HGNC:2960 19p13.13 DNaseII 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03205 pGW-HA.attB ENST00000222219.7 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166209884901

Sequences

DNA sequence (1314 bp) Protein sequence (438 aa)
ATGATCCCGCTGCTGCTGGCAGCGCTGCTGTGCGTCCCCGCCGGGGCCCT
GACCTGCTACGGGGACTCCGGGCAGCCTGTAGACTGGTTCGTGGTCTACA
AGCTGCCAGCTCTTAGAGGGTCCGGGGAGGCGGCGCAGAGAGGGCTGCAG
TACAAGTATCTGGACGAGAGCTCCGGAGGCTGGCGGGACGGCAGGGCACT
CATCAACAGCCCGGAGGGGGCCGTGGGCCGAAGCCTGCAGCCGCTGTACC
GGAGCAACACCAGCCAGCTCGCCTTCCTGCTCTACAATGACCAACCGCCT
CAACCCAGCAAGGCTCAGGACTCTTCCATGCGTGGGCACACGAAGGGTGT
CCTGCTCCTTGACCACGATGGGGGCTTCTGGCTGGTCCACAGTGTACCTA
ACTTCCCTCCACCGGCCTCCTCTGCTGCATACAGCTGGCCTCATAGCGCC
TGTACCTACGGGCAGACCCTGCTCTGTGTGTCTTTTCCCTTCGCTCAGTT
CTCGAAGATGGGCAAGCAGCTGACCTACACCTACCCCTGGGTCTATAACT
ACCAGCTGGAAGGGATCTTTGCCCAGGAATTCCCCGACTTGGAGAATGTG
GTCAAGGGCCACCACGTTAGCCAAGAACCCTGGAACAGCAGCATCACACT
CACATCCCAGGCCGGGGCTGTTTTCCAGAGCTTTGCCAAGTTCAGCAAAT
TTGGAGATGACCTGTACTCCGGCTGGTTGGCAGCAGCCCTTGGTACCAAC
CTGCAGGTCCAGTTCTGGCACAAAACTGTAGGCATCCTGCCCTCTAACTG
CTCGGATATCTGGCAGGTTCTGAATGTGAACCAGATAGCTTTCCCTGGAC
CAGCCGGCCCAAGCTTCAACAGCACAGAGGACCACTCCAAATGGTGCGTG
TCCCCAAAAGGGCCCTGGACCTGCGTGGGTGACATGAATCGGAACCAGGG
AGAGGAGCAACGGGGTGGGGGCACACTGTGTGCCCAGCTGCCAGCCCTCT
GGAAAGCCTTCCAGCCGCTGGTGAAGAACTACCAGCCCTGTAATGGCATG
GCCAGGAAGCCCAGCAGAGCTTATAAGATCTTGCCAACTTTCTTGTACAA
AGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCA
TCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCC
GGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGG
CTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTC
CAGATTACGCTTGA
MIPLLLAALLCVPAGALTCYGDSGQPVDWFVVYKLPALRGSGEAAQRGLQ
YKYLDESSGGWRDGRALINSPEGAVGRSLQPLYRSNTSQLAFLLYNDQPP
QPSKAQDSSMRGHTKGVLLLDHDGGFWLVHSVPNFPPPASSAAYSWPHSA
CTYGQTLLCVSFPFAQFSKMGKQLTYTYPWVYNYQLEGIFAQEFPDLENV
VKGHHVSQEPWNSSITLTSQAGAVFQSFAKFSKFGDDLYSGWLAAALGTN
LQVQFWHKTVGILPSNCSDIWQVLNVNQIAFPGPAGPSFNSTEDHSKWCV
SPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGM
ARKPSRAYKILPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGA
GGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index