Stock Number Hs1511

Human Gene: PCBP4


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
PCBP4 poly(rC) binding protein 4 HGNC:8652 3p21.2 mub 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03203 pGW-HA.attB ENST00000428823.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166209784900

Sequences

DNA sequence (1314 bp) Protein sequence (438 aa)
ATGAGCGGCTCGGACGGGGGACTGGAGGAGGAGCCAGAGCTCAGCATCAC
CCTCACGCTGCGGATGCTGATGCACGGGAAGGAAGTGGGCAGCATCATCG
GGAAGAAGGGCGAGACTGTAAAGCGAATCCGGGAGCAGAGCAGTGCCCGG
ATCACCATCTCCGAGGGCTCCTGCCCTGAACGCATCACCACCATCACCGG
GTCTACAGCAGCTGTCTTCCATGCAGTCTCCATGATTGCTTTCAAACTGG
ATGAGGACCTTTGTGCTGCTCCTGCAAATGGTGGAAATGTCTCCAGGCCT
CCAGTGACCCTGCGCCTTGTCATCCCTGCCAGTCAGTGTGGCTCACTGAT
TGGGAAGGCTGGCACCAAGATCAAGGAGATCCGAGAGTCCCCACCCAAAG
GAGCCACTATCCCCTACCATCCGAGCCTCTCCCTAGGTACTGTTCTTCTC
TCTGCCAACCAGGGCTTCTCTGTCCAGGGTCAGTATGGGGCTGTGACCCC
AGCTGAGGTCACCAAGCTCCAGCAGCTCTCAAGCCATGCGGTCCCCTTTG
CCACACCCAGCGTGGTGCCAGGACTGGATCCCGGCACACAGACCAGCTCA
CAGGAGTTCTTGGTTCCCAACGATTTGATTGGCTGTGTGATCGGGCGCCA
GGGCAGCAAGATCAGCGAGATCCGGCAGATGTCAGGGGCACATATCAAGA
TCGGGAACCAAGCAGAGGGCGCTGGGGAGCGGCATGTCACCATCACTGGC
TCTCCGGTCTCCATCGCCCTGGCCCAGTACCTCATCACTGCCTGTCTAGA
GACGGCCAAGTCTACCTCTGGGGGGACGCCCAGCTCGGCCCCCGCAGACC
TGCCTGCCCCCTTCTCGCCACCCCTGACGGCCCTGCCCACAGCTCCCCCT
GGCCTGCTGGGCACACCCTATGCCATCTCCCTCTCCAACTTCATCGGCCT
CAAGCCCATGCCCTTCTTGGCTTTACCACCTGCTTCCCCAGGGCCGCCGC
CGGGCTTGGCGGCCTACACTGCCAAGATGGCAGCAGCTAATGGGAGCAAG
AAGGCTGAGCGGCAGAAATTCTCCCCCTACTGCCCAACTTTCTTGTACAA
AGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCA
TCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCC
GGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGG
CTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTC
CAGATTACGCTTGA
MSGSDGGLEEEPELSITLTLRMLMHGKEVGSIIGKKGETVKRIREQSSAR
ITISEGSCPERITTITGSTAAVFHAVSMIAFKLDEDLCAAPANGGNVSRP
PVTLRLVIPASQCGSLIGKAGTKIKEIRESPPKGATIPYHPSLSLGTVLL
SANQGFSVQGQYGAVTPAEVTKLQQLSSHAVPFATPSVVPGLDPGTQTSS
QEFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGAGERHVTITG
SPVSIALAQYLITACLETAKSTSGGTPSSAPADLPAPFSPPLTALPTAPP
GLLGTPYAISLSNFIGLKPMPFLALPPASPGPPPGLAAYTAKMAAANGSK
KAERQKFSPYCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGA
GGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index