Stock Number Hs1510

Human Gene: G6PC


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
G6PC glucose-6-phosphatase catalytic subunit HGNC:4056 17q21.31 G6P 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03087 pGW-HA.attB ENST00000253801.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166209684899

Sequences

DNA sequence (1305 bp) Protein sequence (435 aa)
ATGGAGGAAGGAATGAATGTTCTCCATGACTTTGGGATCCAGTCAACACA
TTACCTCCAGGTGAATTACCAAGACTCCCAGGACTGGTTCATCTTGGTGT
CCGTGATCGCAGACCTCAGGAATGCCTTCTACGTCCTCTTCCCCATCTGG
TTCCATCTTCAGGAAGCTGTGGGCATTAAACTCCTTTGGGTAGCTGTGAT
TGGAGACTGGCTCAACCTCGTCTTTAAGTGGATTCTCTTTGGACAGCGTC
CATACTGGTGGGTTTTGGATACTGACTACTACAGCAACACTTCCGTGCCC
CTGATAAAGCAGTTCCCTGTAACCTGTGAGACTGGACCAGGGAGCCCCTC
TGGCCATGCCATGGGCACAGCAGGTGTATACTACGTGATGGTCACATCTA
CTCTTTCCATCTTTCAGGGAAAGATAAAGCCGACCTACAGATTTCGGTGC
TTGAATGTCATTTTGTGGTTGGGATTCTGGGCTGTGCAGCTGAATGTCTG
TCTGTCACGAATCTACCTTGCTGCTCATTTTCCTCATCAAGTTGTTGCTG
GAGTCCTGTCAGGCATTGCTGTTGCAGAAACTTTCAGCCACATCCACAGC
ATCTATAATGCCAGCCTCAAGAAATATTTTCTCATTACCTTCTTCCTGTT
CAGCTTCGCCATCGGATTTTATCTGCTGCTCAAGGGACTGGGTGTAGACC
TCCTGTGGACTCTGGAGAAAGCCCAGAGGTGGTGCGAGCAGCCAGAATGG
GTCCACATTGACACCACACCCTTTGCCAGCCTCCTCAAGAACCTGGGCAC
GCTCTTTGGCCTGGGGCTGGCTCTCAACTCCAGCATGTACAGGGAGAGCT
GCAAGGGGAAACTCAGCAAGTGGCTCCCATTCCGCCTCAGCTCTATTGTA
GCCTCCCTCGTCCTCCTGCACGTCTTTGACTCCTTGAAACCCCCATCCCA
AGTCGAGCTGGTCTTCTACGTCTTGTCCTTCTGCAAGAGTGCGGTAGTGC
CCCTGGCATCCGTCAGTGTCATCCCCTACTGCCTCGCCCAGGTCCTGGGC
CAGCCGCACAAGAAGTCGTTGTTGCCAACTTTCTTGTACAAAGTGGTGGT
ACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAG
CTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCT
GCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTA
TGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACG
CTTGA
MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIW
FHLQEAVGIKLLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSVP
LIKQFPVTCETGPGSPSGHAMGTAGVYYVMVTSTLSIFQGKIKPTYRFRC
LNVILWLGFWAVQLNVCLSRIYLAAHFPHQVVAGVLSGIAVAETFSHIHS
IYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEKAQRWCEQPEW
VHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWLPFRLSSIV
ASLVLLHVFDSLKPPSQVELVFYVLSFCKSAVVPLASVSVIPYCLAQVLG
QPHKKSLLPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGP
AGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index