Stock Number Hs1509

Human Gene: RAX


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
RAX retina and anterior neural fold homeobox HGNC:18662 18q21.32 Rx 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03042 pGW-HA.attB ENST00000334889.3 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166209584898

Sequences

DNA sequence (1284 bp) Protein sequence (428 aa)
ATGCACCTGCCGGGCTGCGCGCCAGCCATGGCCGACGGGAGCTTCTCGCT
TGCCGGCCACCTGCTCCGCAGCCCGGGCGGGAGCACCTCGCGACTTCACA
GCATCGAGGCCATCCTGGGGTTTACCAAGGACGACGGGATCCTCGGCACC
TTCCCGGCGGAGCGGGGCGCCCGGGGCGCGAAGGAGCGGGATAGGAGGCT
GGGCGCGCGGCCCGCCTGCCCCAAGGCGCCCGAGGAAGGCTCCGAGCCCT
CCCCGCCGCCAGCCCCGGCGCCCGCCCCCGAGTACGAAGCCCCTCGACCC
TACTGCCCCAAGGAGCCCGGGGAGGCACGGCCGAGCCCAGGGCTGCCCGT
CGGGCCAGCCACCGGCGAAGCGAAACTGTCAGAGGAGGAACAGCCCAAGA
AAAAGCATCGGCGGAACCGCACGACTTTCACCACGTACCAGCTGCATGAG
CTGGAGCGCGCGTTCGAGAAGTCCCACTACCCGGACGTGTACAGCCGCGA
GGAGCTGGCCGGCAAGGTCAACCTACCAGAGGTCCGGGTCCAGGTGTGGT
TCCAGAACCGACGGGCTAAGTGGCGGCGGCAGGAGAAGCTGGAAGTGTCC
TCCATGAAGCTGCAGGACTCGCCCCTCCTCTCCTTCAGCCGCTCCCCGCC
CTCCGCGACGCTGTCGCCCCTCGGGGCGGGCCCGGGCAGCGGTGGCGGGC
CGGCTGGGGGCGCGCTGCCGCTGGAGTCCTGGCTCGGGCCGCCGCTGCCG
GGCGGGGGCGCCACGGCGCTGCAGAGCCTGCCGGGCTTCGGGCCGCCGGC
GCAGAGCCTGCCTGCCAGCTACACGCCACCGCCGCCGCCTCCGCCCTTCC
TGAACTCCCCGCCGTTGGGCCCCGGCCTGCAACCTCTCGCGCCGCCGCCG
CCCTCCTACCCGTGCGGGCCCGGCTTCGGGGACAAGTTCCCGCTGGACGA
GGCGGACCCGCGCAACAGCAGCATCGCGGCGCTGCGTCTGAAAGCCAAGG
AGCACATCCAGGCCATCGGGAAGCCGTGGCAGGCCCTCTCAGGCCTCATG
GGCCCAGCTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCT
ACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTA
CTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATAC
GATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGG
ATCCTATCCATATGACGTTCCAGATTACGCTTGA
MHLPGCAPAMADGSFSLAGHLLRSPGGSTSRLHSIEAILGFTKDDGILGT
FPAERGARGAKERDRRLGARPACPKAPEEGSEPSPPPAPAPAPEYEAPRP
YCPKEPGEARPSPGLPVGPATGEAKLSEEEQPKKKHRRNRTTFTTYQLHE
LERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAKWRRQEKLEVS
SMKLQDSPLLSFSRSPPSATLSPLGAGPGSGGGPAGGALPLESWLGPPLP
GGGATALQSLPGFGPPAQSLPASYTPPPPPPPFLNSPPLGPGLQPLAPPP
PSYPCGPGFGDKFPLDEADPRNSSIAALRLKAKEHIQAIGKPWQALSGLM
GPAFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPY
DVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index